KEGG   Shewanella denitrificans: Sden_2312Help
Entry
Sden_2312         CDS       T00344                                 

Definition
GGDEF domain-containing protein
Orthology
K13590  
diguanylate cyclase
Organism
sdn  Shewanella denitrificans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2737680..2738705
Genome map
AA seq 341 aa AA seqDB search
MSNDLLQTAALNLKKAVPLMLKYKIPTTPTNYALWYAYVGEQNPALNQELDNLIQQNISY
SPVSSELLYRKHVSDPVELDVRTMRQSLDAMVCDLSQSLKDTNQDTVSFQSRIEKDFNKL
NELESQGFSLEQVIGVVRSIVKESTSIRSSAVNFSQQLLKAQSEIDTLKVKLAETEKDML
FDALTNVLNRRAFDEDIRAIVAQKTAGNCLVLLDIDHFKAFNDNYGHQLGDMVLKTVAKR
VQEGCRDGTKLYRFGGEEFAIIIPKSQLRVARQLADGLRRAIEKLTLKDRRNDTKIDAIT
ASFGVSEWQPGQSVAEFIEATDKLLYQAKHLGRNRVMPMSG
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaacgatctattacaaacggccgcattaaacctgaaaaaagccgtccccttgatg
ctcaagtataaaatccctaccacccccactaattatgccttgtggtatgcctatgtaggg
gaacaaaacccggccttgaatcaagagcttgataacttgatacagcagaatattagttat
tctcctgtcagcagcgagttattatatcgcaagcatgtgtccgatcctgtcgaacttgat
gtacgcactatgcgtcagagcttagatgccatggtgtgtgatctatcacaatcactaaaa
gacaccaatcaagatactgtgtcatttcagagtcgcatcgaaaaagatttcaataaacta
aacgagttagaaagccaaggcttctccttagagcaagtgattggtgtggtgcgaagcata
gtcaaggagtccaccagtattcgctctagtgctgtcaatttttcccagcagttacttaag
gcacaatctgagatagataccttaaaagtaaaacttgcagagacagaaaaggacatgttg
ttcgatgcgctcaccaatgtgctcaatcgccgtgcatttgatgaagatattcgcgctatt
gtcgcccaaaagactgctggtaactgcctggtattgttagatattgaccattttaaagcc
tttaatgacaattatggtcatcaactcggtgacatggtactaaaaaccgtggctaaacgg
gtgcaagaaggttgtcgcgacgggactaaattgtatcgctttggcggtgaagaatttgcc
atcatcatacctaagagccaacttagggtggctcgtcagttagccgatggactgcgccgc
gccatcgaaaaactgaccctaaaagacagacgcaacgacactaagatagacgctattacg
gcctcctttggtgtcagtgaatggcagccaggccaaagtgtagctgagtttattgaagcc
acagataagttactctatcaagccaaacaccttggccgtaatcgcgtaatgcccatgtct
ggctaa

DBGET integrated database retrieval system