KEGG   Shewanella denitrificans: Sden_2312Help
Entry
Sden_2312         CDS       T00344                                 

Definition
(GenBank) diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
sdn  Shewanella denitrificans
Brite
Enzymes [BR:sdn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     Sden_2312
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2737680..2738705
Genome map
AA seq 341 aa AA seqDB search
MSNDLLQTAALNLKKAVPLMLKYKIPTTPTNYALWYAYVGEQNPALNQELDNLIQQNISY
SPVSSELLYRKHVSDPVELDVRTMRQSLDAMVCDLSQSLKDTNQDTVSFQSRIEKDFNKL
NELESQGFSLEQVIGVVRSIVKESTSIRSSAVNFSQQLLKAQSEIDTLKVKLAETEKDML
FDALTNVLNRRAFDEDIRAIVAQKTAGNCLVLLDIDHFKAFNDNYGHQLGDMVLKTVAKR
VQEGCRDGTKLYRFGGEEFAIIIPKSQLRVARQLADGLRRAIEKLTLKDRRNDTKIDAIT
ASFGVSEWQPGQSVAEFIEATDKLLYQAKHLGRNRVMPMSG
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaacgatctattacaaacggccgcattaaacctgaaaaaagccgtccccttgatg
ctcaagtataaaatccctaccacccccactaattatgccttgtggtatgcctatgtaggg
gaacaaaacccggccttgaatcaagagcttgataacttgatacagcagaatattagttat
tctcctgtcagcagcgagttattatatcgcaagcatgtgtccgatcctgtcgaacttgat
gtacgcactatgcgtcagagcttagatgccatggtgtgtgatctatcacaatcactaaaa
gacaccaatcaagatactgtgtcatttcagagtcgcatcgaaaaagatttcaataaacta
aacgagttagaaagccaaggcttctccttagagcaagtgattggtgtggtgcgaagcata
gtcaaggagtccaccagtattcgctctagtgctgtcaatttttcccagcagttacttaag
gcacaatctgagatagataccttaaaagtaaaacttgcagagacagaaaaggacatgttg
ttcgatgcgctcaccaatgtgctcaatcgccgtgcatttgatgaagatattcgcgctatt
gtcgcccaaaagactgctggtaactgcctggtattgttagatattgaccattttaaagcc
tttaatgacaattatggtcatcaactcggtgacatggtactaaaaaccgtggctaaacgg
gtgcaagaaggttgtcgcgacgggactaaattgtatcgctttggcggtgaagaatttgcc
atcatcatacctaagagccaacttagggtggctcgtcagttagccgatggactgcgccgc
gccatcgaaaaactgaccctaaaagacagacgcaacgacactaagatagacgctattacg
gcctcctttggtgtcagtgaatggcagccaggccaaagtgtagctgagtttattgaagcc
acagataagttactctatcaagccaaacaccttggccgtaatcgcgtaatgcccatgtct
ggctaa

DBGET integrated database retrieval system