KEGG   Shewanella denitrificans: Sden_2353Help
Entry
Sden_2353         CDS       T00344                                 

Definition
exodeoxyribonuclease V, alpha subunit (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
sdn  Shewanella denitrificans
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sdn00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Sden_2353
Enzymes [BR:sdn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Sden_2353
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2797650..2799953
Genome map
AA seq 767 aa AA seqDB search
MTKQKTPPMIALTPIALGRTALSQTAQAQIAPSLRERLKYWQELRLLTPLDRHFALSLCD
IEGLDNHSSEAELFMLICALLSRQLSNQHSCLVLSQIDLANPMMEECYRAPASCSINLSL
TELEHQLSQFSAVGQAGDNTPLILDTGCLYLNKYHFFETHVAHKLNRLAQTELIATSNAF
DAGTLNQVRQQLDCLFPAAENAQIDWQKVATATALTKALAVITGGPGTGKTTTVTKLLLL
LQTQSAMNIKLVAPTGKAAARLSESIKDSKAKLHDFLCAQLSQQLSLQLKQAESPLASTS
STQSSPPKKQAQGQMSLDFDHTVVENQTGAENQTVADIQTENVNPDSSSLLALKQLIASL
SLIPEEASTLHRLLGVIPNSHKFRHDEHNPLRLDLLVVDEASMVDLPMMHKLLSALPKDA
RLILLGDQDQLASVEAGAVLADICAGLKAPASSAAQWQMRYSHEQALLLEALTGEKLTRY
IHPQARLGDSLCILFHSHRFKGDAGIGLLAAAVNHADIKAIRQVWQQQHQELNWFEHQAD
SNSAQGKDALLALSVSAYGDYLSLIADNKRQFEITDASALHSPKTIIDSFNQYRILCAMR
AGEFGVDGINAALTQALKQRKLIDPKQEFYLGRPIIIASNDYNLGLFNGDIGLILQDKDQ
PTRLMAHFIKADGSVLKVQPARLPSHDTCYAMTVHKSQGSEFAKVSFVLPPKPSTAQWQL
LTKELLYTAITRAKAQFYCLGSQPVFERASRQVTLRASGLARRLWDE
NT seq 2304 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagcaaaaaacgccgccaatgatagcgctgacgccgatagcattagggcggact
gcactgagccaaactgctcaggctcaaatagcgccaagcttaagagagcggcttaaatat
tggcaagagctgcgtttactcacgccgcttgacaggcactttgccttgtccctttgtgat
attgaaggtttggataaccacagctcagaagctgagctatttatgctcatctgcgcgctg
ttaagtaggcagttatcaaatcagcacagctgcttagtgctgtcgcaaattgacttagct
aaccctatgatggaagagtgctaccgcgctcccgcctcttgcagcattaacttaagctta
actgagcttgaacatcaactcagtcaatttagcgcggtaggccaagccggcgacaatacc
ccgctaatcttagatacaggctgcctgtacttaaataagtatcacttttttgagacccac
gttgcccataaactcaatcgattagcacaaaccgaactcatagcgactagcaatgcgttt
gatgcaggcacgcttaatcaagtgcgtcagcaactggattgcctgttccccgccgctgaa
aatgcgcagatagactggcaaaaagtcgccaccgccaccgcgctcaccaaggccttagct
gtcatcactggcggccctggtacaggtaaaaccactaccgtgactaagttgctactgtta
ttgcaaactcagtcagcaatgaacatcaaattagtggctccgactggaaaggcggcggcg
cgcctcagtgaatccattaaagactcgaaagctaagctgcatgactttctttgcgcccag
ctttcccagcaactttccttgcaacttaagcaggctgaaagccctcttgcttcaacgtcg
tcaacgcaaagttcaccgccaaagaaacaggctcaagggcagatgagcctagactttgac
catactgttgttgaaaaccaaaccggcgctgaaaaccaaacggtcgctgacatccaaact
gagaatgtgaacccagactctagcagtctgttagcccttaagcagttaatcgcctcactt
agccttattccagaagaggcctcgaccctgcaccgtttattgggggttatccctaattcc
cacaagtttaggcatgatgagcataatcccctgaggttagatttattggtggtggatgaa
gcctccatggtggatttacctatgatgcacaaattgttaagtgccctacctaaagatgcg
cggctgattttacttggggatcaagaccaattggcctcagtggaagccggcgccgtgtta
gcggatatttgcgcaggacttaaggcgccagcctcgagtgcggcgcaatggcagatgcgt
tattctcatgaacaagctctattgcttgaggcattaacaggggaaaaactgacaagatat
attcatccacaagccagacttggggatagcttgtgcatcttgtttcacagccacagattt
aaaggcgatgccggcattggtcttttagccgcagcggtgaatcacgccgatattaaggcc
atcagacaagtgtggcagcaacaacatcaggagcttaactggtttgagcatcaagctgac
tcaaattcagctcaaggaaaagacgccttgctggcactatccgtgtctgcctatggtgat
tatctaagcttaattgcagacaataagcgccaatttgagataactgatgccagtgcgctt
catagccccaagaccattatcgacagctttaatcaataccggattttatgcgccatgcgc
gccggtgaatttggtgtcgatggcattaatgctgccctgacccaagcgctaaaacagcgc
aaacttattgaccccaaacaagagttctatcttggaaggcccattattattgccagtaac
gactacaatttagggcttttcaatggcgatatcgggctgattttacaagacaaagatcaa
cccactcgcttgatggcacactttatcaaggccgatggcagcgtgcttaaagttcagccc
gcgcgcctgccaagtcacgatacctgttatgccatgacagtgcataagagtcagggcagc
gaatttgccaaggtgagttttgtgctgccgccaaagcccagtacagcccaatggcaattg
ctgaccaaagaactgctctataccgcgataacccgcgctaaagcacaattttattgcttg
ggaagccagccagtgtttgagcgagccagccgtcaagtgaccttaagggcatcgggactt
gcgcgtcgcttatgggatgaatga

DBGET integrated database retrieval system