KEGG   Shewanella denitrificans: Sden_2368Help
Entry
Sden_2368         CDS       T00344                                 

Definition
arylesterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
sdn  Shewanella denitrificans
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:sdn00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Sden_2368
Enzymes [BR:sdn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Sden_2368
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Sden_2368
Lipid biosynthesis proteins [BR:sdn01004]
 Fatty acid synthase
  Component type
   Sden_2368
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2818890..2819456
Genome map
AA seq 188 aa AA seqDB search
MLIILCSPSYAATILVLGDSLSAGYGIDEHQGWVQLLQQDLSQHTLINGSVSGETTAGAL
RRLPSLLASSKIDLVLIELGGNDGLRGFPPAQLKSNLTKIVELAQENSAKVLLTEIRVPP
NYGPRYSKAFNQVYHQLAQEHSLTLAPFFMSQIAPDRELMQRDGIHPNAKAQPLISQWMK
PWIETALN
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgctgattatcttatgttcgcccagctatgctgccacgattttggtcttaggtgatagc
ttaagtgcaggatatggcatagatgaacatcaaggttgggtacaattgttacaacaggac
ttaagccaacatacactgatcaacggttctgtcagtggtgaaaccacagcgggcgcccta
cgtagactcccgagtttactggcgtctagcaagattgacttagtgctgattgaactcggt
ggtaatgatgggctcagagggttcccccccgcacagctgaaatcaaatcttacaaaaatc
gttgagcttgctcaagaaaatagcgccaaagtcctattaaccgaaattagggtgccgccc
aattacggccctagatacagtaaagcctttaatcaggtttatcatcaactggctcaagag
cattcactcaccttagcgccgttttttatgtcacaaatagcgccagacagggaattaatg
caaagagatggcattcaccccaatgctaaggcgcagcccttaatcagccaatggatgaag
ccatggattgaaaccgcattaaattag

DBGET integrated database retrieval system