KEGG   Shewanella denitrificans: Sden_2368Help
Entry
Sden_2368         CDS       T00344                                 

Definition
arylesterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
sdn  Shewanella denitrificans
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:sdn01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2818890..2819456
Genome map
AA seq 188 aa AA seqDB search
MLIILCSPSYAATILVLGDSLSAGYGIDEHQGWVQLLQQDLSQHTLINGSVSGETTAGAL
RRLPSLLASSKIDLVLIELGGNDGLRGFPPAQLKSNLTKIVELAQENSAKVLLTEIRVPP
NYGPRYSKAFNQVYHQLAQEHSLTLAPFFMSQIAPDRELMQRDGIHPNAKAQPLISQWMK
PWIETALN
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgctgattatcttatgttcgcccagctatgctgccacgattttggtcttaggtgatagc
ttaagtgcaggatatggcatagatgaacatcaaggttgggtacaattgttacaacaggac
ttaagccaacatacactgatcaacggttctgtcagtggtgaaaccacagcgggcgcccta
cgtagactcccgagtttactggcgtctagcaagattgacttagtgctgattgaactcggt
ggtaatgatgggctcagagggttcccccccgcacagctgaaatcaaatcttacaaaaatc
gttgagcttgctcaagaaaatagcgccaaagtcctattaaccgaaattagggtgccgccc
aattacggccctagatacagtaaagcctttaatcaggtttatcatcaactggctcaagag
cattcactcaccttagcgccgttttttatgtcacaaatagcgccagacagggaattaatg
caaagagatggcattcaccccaatgctaaggcgcagcccttaatcagccaatggatgaag
ccatggattgaaaccgcattaaattag

DBGET integrated database retrieval system