KEGG   Shewanella denitrificans: Sden_2454Help
Entry
Sden_2454         CDS       T00344                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sdn  Shewanella denitrificans
Pathway
sdn00260  Glycine, serine and threonine metabolism
sdn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sdn01100  Metabolic pathways
sdn01110  Biosynthesis of secondary metabolites
sdn01130  Biosynthesis of antibiotics
sdn01230  Biosynthesis of amino acids
Module
sdn_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sdn00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sden_2454
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sden_2454
Enzymes [BR:sdn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Sden_2454
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABE55734
JGI: Sden2454
UniProt: Q12LE2
Position
2925250..2926455
Genome map
AA seq 401 aa AA seqDB search
MTELKLDPYFGEYGGMYVPQILVPALKQLESAFVDAQQDPAFQAEFTDLLKNYAGRPTAL
TLTRNLSPNPLVKIYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGAGQHGVAT
ALACALLGLKCKVYMGAKDVERQSPNVFRMKLMGAEVIPVTSGSATLKDACNEAMRDWSA
SYDKAHYLLGTAAGPHPFPTIVREFQRMIGEETKQQILEKEGRLPDAVIACVGGGSNAIG
MFADFIDEPSVELIGVEPAGKGIDTPMHGAPLKHGKTGIFFGMKAPLMQDRDGQIEESYS
VSAGLDFPSVGPQHAHLNAIGRARYESATDDEALAMFQQLARCEGIIPALESAHALAYAV
KLAKTATKETILVVNLSGRGDKDIFTVSDILAAKEQESGND
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgacagagcttaagcttgacccttattttggtgaatatggcggcatgtacgtaccgcaa
attctggtgcccgcccttaaacaattggaaagcgcttttgtggacgcccagcaagaccca
gcatttcaggcagaatttaccgatttactgaaaaactacgcaggtcgcccaacggcgcta
actttaacccgtaacttaagccctaatccgctagtgaaaatttacctaaagcgtgaagac
ttactccacggcggcgcccataagactaaccaagtgttaggtcaggcattgctcgctaag
cgtatgggtaagaaagagattattgcagaaactggcgcggggcagcacggcgttgccacc
gcccttgcctgcgcgctgttggggcttaaatgtaaagtgtacatgggcgcaaaagatgtt
gagcgtcaatcccccaacgtgtttcgcatgaagctgatgggcgctgaagttattcctgtg
acctcaggctctgccaccttaaaagatgcctgtaatgaggccatgcgcgactggtcagca
agttatgataaggcccattatttattaggcacggccgcaggtccgcaccctttccctacc
atagtacgtgaatttcagcgcatgataggtgaagaaaccaagcagcaaatattagaaaaa
gaaggccgtttgcccgatgcggtcatcgcctgtgtgggcggcggctcaaacgccatcggc
atgttcgcggatttcattgatgagccgagtgttgagcttatcggcgtggaacccgctggt
aaaggtatagacaccccaatgcacggcgcgccgttaaagcatggtaaaaccgggatattc
ttcggcatgaaggcccccttaatgcaagacagagacggccagattgaagagtcatactct
gtctcagcaggtcttgatttcccgtcagtggggccacaacatgcgcaccttaacgccatc
ggccgcgcccgctatgagtcagccacagacgatgaagccttagccatgttccagcagctt
gcccgctgtgaaggcatcatcccagcgttggagtcggcccacgcgttagcgtatgcggta
aaacttgccaaaactgccaccaaggaaaccattctcgtggttaatttatcggggcgcggt
gacaaggacatcttcactgtgtctgacattttagcggccaaagaacaggagagcggcaat
gactaa

DBGET integrated database retrieval system