KEGG   Shewanella denitrificans: Sden_2455Help
Entry
Sden_2455         CDS       T00344                                 

Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sdn  Shewanella denitrificans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sdn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sden_2455
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sden_2455
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sden_2455
Enzymes [BR:sdn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Sden_2455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2926448..2927293
Genome map
AA seq 281 aa AA seqDB search
MTNTITNAMTHEMSNRYQQAFAALNAKNQGALVPFVTLGDPSFELSQKIINTLIESGADA
LELGFPFSDPLADGPVIQGANLRALEAGMKTKDCFELIRQTRAAHPDLPIGLLLYANLVF
GNGIDNFYAKASEAGVDSVLIADVPVEEAAPFIESAKKHGIAPIFIAPPNADDDTLRAVS
SKGEGYTYLLSRAGVTGTESKAGEPIEAILAKLSEFHAPPPLLGFGIAEPAQVAAAIKAG
AAGAISGSAVVKIIEAHKDDEAKLLSTLSDFIKAMKAATYK
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgactaacacaataactaacgcaatgactcacgaaatgagcaacagatatcagcaagct
tttgcagccctgaatgccaaaaatcaaggcgcgctagtgccgtttgtgaccttgggcgac
ccaagctttgaattgtcacaaaaaatcattaataccttgatagaaagtggcgccgatgcc
ctagagctcggctttcccttctcagatcctctcgcagatggccccgtgatccaaggtgcc
aacttaagggcgttagaggccggcatgaagaccaaagattgctttgagcttatccgccaa
actcgcgccgcccacccagatttacccatagggttgctcttatacgctaacttagtgttt
ggtaacggcatagataatttctacgccaaggcaagcgaagctggggtcgattcagtgctt
atcgccgatgtgcccgtggaagaggctgcgccctttattgagtctgccaaaaagcatggc
atagccccgatttttatcgccccgccaaacgccgatgacgacaccttacgcgctgtcagt
agtaaaggcgaaggctacacctatttactgtcccgcgcaggcgtcacaggcacagaatca
aaagcgggcgagcccatagaagccatcttggcaaagctgagcgaatttcacgcccccccg
cccctgcttgggtttggtatcgccgaacctgcccaagtggccgccgctatcaaagccggc
gccgcaggtgctatctcaggctccgccgtggttaaaattatcgaagcccataaggatgat
gaagccaagctgctatctactttaagcgacttcatcaaagccatgaaagccgcaacttat
aagtag

DBGET integrated database retrieval system