KEGG   Shewanella denitrificans: Sden_2596Help
Entry
Sden_2596         CDS       T00344                                 

Definition
(GenBank) UDP-glucose pyrophosphorylase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sdn  Shewanella denitrificans
Pathway
sdn00040  Pentose and glucuronate interconversions
sdn00052  Galactose metabolism
sdn00500  Starch and sucrose metabolism
sdn00520  Amino sugar and nucleotide sugar metabolism
sdn01100  Metabolic pathways
sdn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sdn00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Sden_2596
   00052 Galactose metabolism
    Sden_2596
   00500 Starch and sucrose metabolism
    Sden_2596
   00520 Amino sugar and nucleotide sugar metabolism
    Sden_2596
Enzymes [BR:sdn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Sden_2596
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3 Peptidase_M18
Motif
Other DBs
NCBI-ProteinID: ABE55875
JGI: Sden2596
UniProt: Q12L01
Position
3106737..3107642
Genome map
AA seq 301 aa AA seqDB search
MKTHLVRKAVIPVAGLGTRMLPATKAIPKEMLPIVDKPLIQYVVSEAIAAGIKEIVLVTH
ASKNSIENHFDTSFELEAQLERRVKRQLLDAVQSICPKDVTVISVRQSQAKGLGHAILCA
KHVVGDNPFAVLLPDVLVDEASCDLRRDNLAKMVSLFDETQVGQIMVEGVDHAVVDQYGI
ADVNGHDLKPGESKPLIALVEKPSIDEAPSNLAVVGRYVLPAEIWPLLAKTPAGAGDEIQ
LTDAIAMLMQQQTVNAYAMEGKSHDCGNKQGYMRANVEYALRHAEIGCDFSQYLKALVKE
R
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaagactcatctcgttcgtaaggctgtcatccctgttgctggccttggcactcgcatg
ttaccggccactaaggccattcccaaagaaatgctgcccatagtggataagccactcatt
caatacgtggtatctgaagctattgccgccggcattaaagaaatcgtgctggtgacccat
gccagtaaaaactccatcgagaaccatttcgacaccagttttgagctagaagcccaatta
gagcggcgggtaaaacgtcagctattagatgcggtgcaatcgatttgccccaaagatgtg
actgtgatcagcgtgcgtcaatcccaagctaagggcctaggccacgctattttgtgcgct
aaacacgtggtgggtgataatcccttcgcggtattgttaccggacgtattagtggatgag
gctagctgcgatcttcgccgtgataaccttgccaagatggtcagcctgttcgatgaaaca
caagtgggccaaatcatggttgaaggtgttgaccatgctgtggttgatcaatacggcatt
gccgatgtgaatggtcacgatctcaagccgggtgaatccaagccactcatcgcgcttgtt
gaaaagccaagcatagatgaagcgccatcaaacctcgcggttgtgggccgctatgtactc
ccagctgaaatttggcccttattagccaagacccctgcgggcgccggcgatgaaattcag
ctcaccgacgccatcgccatgttaatgcagcagcaaaccgtcaatgcctatgccatggaa
ggcaagagtcatgattgcggcaataaacaaggctatatgcgcgccaatgtggaatacgcc
ctgcgtcacgctgaaatcggctgtgattttagtcaataccttaaagccttagtcaaggag
cgctaa

DBGET integrated database retrieval system