KEGG   Shewanella denitrificans: Sden_2655Help
Entry
Sden_2655         CDS       T00344                                 

Definition
hypothetical protein
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
sdn  Shewanella denitrificans
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sdn00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Sden_2655
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Sden_2655
Enzymes [BR:sdn01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Sden_2655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3187044..3187472)
Genome map
AA seq 142 aa AA seqDB search
MIDGIVITRLKRILNEKGDIYHALKNSDESFSSFGEAYFSSVHLDDIKGWKKHTKMILNL
VVPVGSIRFVFYDDRYESNSYGEYVDVIASPDNYVRLTVPAGVWVAFQGVGSGLNLLLNI
ASIEHDPSESISEALSYIPYKW
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgattgacggaattgttattactcgattaaagcgaatattaaatgagaaaggtgatatt
tatcatgctttaaaaaattccgatgaaagctttagttcatttggtgaagcatatttttct
agtgttcatttagatgatattaaaggctggaaaaaacatacgaaaatgattctaaactta
gttgtaccagttggtagcataagatttgttttctatgacgatagatatgaaagtaattcg
tatggtgagtatgtagatgtcatagcgtctcctgataattatgttcgactaacagtccct
gctggtgtctgggttgcatttcaaggcgttggttctggattgaatctgttactaaatatt
gccagtattgaacatgatccttcagaatctatttcagaggcattaagttatattccttat
aagtggtaa

DBGET integrated database retrieval system