KEGG   Shewanella denitrificans: Sden_2695Help
Entry
Sden_2695         CDS       T00344                                 

Definition
(GenBank) Glutaminase (EC:3.5.1.2)
  KO
K01425  
glutaminase [EC:3.5.1.2]
Organism
sdn  Shewanella denitrificans
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sdn00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Sden_2695
   00220 Arginine biosynthesis
    Sden_2695
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Sden_2695
Enzymes [BR:sdn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Sden_2695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(3228686..3229600)
Genome map
AA seq 304 aa AA seqDB search
MTEQLLLEQVVEQVRPLLGKGKVADYIPALANVSSNKIAIAITTMDGITIGAGDYLEPFS
IQSISKVFSLTAALGLYEEDEIWQRVGKEPSGHSFNSLVQVELERGKPRNPFINAGALII
ADLLQSRLGAPKQRMLEIVRQLSCNPKIGYDKVVADSEYQFSARNAAIAYLMKSFGNFDG
DVDTVLKSYFHYCALKMNCADLSKAMFYLANRGKTLTGEQLVTPIQTRQLNALLATSGLY
DGAGEFAYRVGMPGKSGVGGGIIAVIPGDMSICAWSPALDANGNSLAGTAMLELLSQKLG
RSIF
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgacagagcaattactgttagagcaagtggtcgaacaggttcgacccttgctgggtaag
ggcaaggttgctgactatataccagcccttgctaatgtgagttcgaataaaattgccatt
gccattaccactatggatggcatcacgattggggctggagattatctcgagcctttttct
attcagagtatttctaaggtatttagcctcacggcagcactgggcctgtatgaagaagat
gaaatctggcaacgcgttggcaaagagccttccggccattcatttaactcattagtccaa
gtggaattggagcgaggaaaacctcgtaatccttttattaatgctggcgccttgatcatc
gccgatttacttcaaagccgtctcggtgcgcccaaacaacgcatgcttgaaattgtacgg
caactgagttgtaacccaaaaattggatacgacaaggtggtggcagattctgaatatcaa
ttcagtgcccgtaatgccgccattgcttacttgatgaaatcctttggcaactttgatggt
gatgtggatactgtgcttaaaagctatttccattactgcgcccttaagatgaattgcgct
gacctttctaaagccatgttctaccttgcaaatcgcggaaaaacgctaactggcgagcaa
ctggtgacccccattcaaacgaggcagctcaatgccttgctagccacatcgggtttatac
gatggtgcaggggagtttgcttatcgtgtcggcatgccgggtaagagcggtgtgggcggc
gggatcatcgccgtgatcccaggcgacatgtctatctgtgcttggtcgccagcgttggat
gccaatggtaactcgttagcgggtacagccatgttagagttactcagccaaaagcttggc
cgttcaattttctag

DBGET integrated database retrieval system