KEGG   Shewanella denitrificans: Sden_2731Help
Entry
Sden_2731         CDS       T00344                                 

Definition
phosphoketolase (EC:4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
sdn  Shewanella denitrificans
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sdn00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Sden_2731
Enzymes [BR:sdn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     Sden_2731
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3270590..3272956
Genome map
AA seq 788 aa AA seqDB search
MTQANEIKALKKYVRATNFLATSQIYLKQNVLYKRQLEHTDIKPRLLGHWGTCPGINFVY
ANINRLIVKHNREFIYLVGPGHGFPAVQANLFMEGSLSHFYPETIPFTETGIEDICKKFS
AAYGYPSHANPEAPGQILEGGELGYSLSVAWGSVLDNPNLIAACLIGDGEAETGPLAASW
YANRLVSPANNGAVLPIVHINGYKISGPTRMGRMSHEELDLEFRGLGYHPIIVDDEQDTD
IYEQMTAAMDLSYEMITDIQRRARSGEDVVKPRWPVILMRTAKGWTGTSEYAGKKLEGNC
ESHQVIVNNCATDKGHLNALDQWLASYKFDELVQTTETGELVFDKDILLLIPPKDLCCGR
QRLSYGGEVVRALANPDLAKLGYGAETPRGQRGYSMLKMGQWMRDAFKLNRDQRNLRIFS
PDETYSNQLQAVFEETDRAWQWPIESWDQDMSRDGRVIELLSENLLFGMLHGYTVTGRHG
MFPTYEAFSQVVSSMADQYCKYVHASQGIHFRKPIPACNVVLSSLLERQDHNGYSHQNPS
FLGAMLEKHPNIISAYLPADANSTLVYTERAYGDRDKLNIIVAGKKSLPQWLSLDEARKQ
AKDGIMVWDFASDENPDVVLAGCGDYATQECMASLVLIREILPRVRIRFVSVSELHSSGL
GSLKFQSKPWMMDEVFTEDKGVVFNYHGYPNTIKKLVFDYKGNRRFRIKGYEEEGSTTTP
FDMGVRNGTSRYHLVIDMAYKLFQQGVIDETQHVRITTDMLQRLVDHKNYIKANGVDPVE
IENWVWTR
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atgacacaagctaacgaaattaaggcgcttaaaaagtatgttagagcaacaaacttttta
gccacctctcaaatctaccttaagcaaaacgtcctctacaaacgtcagcttgagcacaca
gatattaagcctagattactggggcactggggaacttgcccagggatcaactttgtctac
gccaacataaaccgacttatcgttaagcataatcgtgaatttatctatcttgtaggccca
ggtcatggcttccctgcggtgcaggccaacctatttatggaaggttccctaagccatttt
tatccagaaaccatcccatttacagaaactggcatcgaagatatttgtaaaaaattctca
gcggcatacggttatccatcacatgctaacccagaagccccaggccaaatccttgaaggt
ggtgagctaggttattccttgtctgtcgcatggggctctgtgctcgataaccccaacctg
attgcagcctgtttaattggtgatggtgaagctgaaactggaccactggccgcctcttgg
tacgctaaccgcttagtgtctccagccaataacggtgcggtattgccaatcgtgcatatc
aatggctataaaatttcaggtcccactcgcatgggccgcatgagccatgaagaacttgat
ttagaattccgcggtctgggctatcaccccatcattgtcgatgacgaacaggatactgac
atctatgagcagatgacagcggcaatggatttatcctatgagatgatcaccgacatacag
cgccgcgctcgctctggtgaagatgtggttaagccgcgctggccggtgatcttaatgaga
acagctaaaggctggacgggtacctctgaatacgcaggtaaaaagcttgaaggcaactgc
gaatctcaccaagttatcgttaacaattgtgctaccgacaagggccacctaaacgcgctt
gatcaatggctcgccagctacaaatttgatgaactagtacaaaccactgaaactggcgaa
ttagtatttgataaagacattttattgctaataccaccaaaagacttatgctgtggccgc
caacgcttaagctacggtggtgaagtggtacgtgccttagctaatccagatttggctaag
ctgggttatggcgccgaaaccccgcgtggacaacgtggttactccatgttgaaaatgggc
cagtggatgcgtgatgcatttaaactgaaccgcgatcaacgtaatctgcgtatcttcagc
ccagatgaaacctattcaaaccaacttcaagccgtgtttgaagaaacagatcgcgcttgg
cagtggccaattgaaagctgggatcaagatatgtctcgtgatggccgcgtgattgagttg
ctgtcagagaacttgctgttcggtatgttacacggttacacagtaacgggtcgtcacggc
atgttcccaacgtatgaggctttctctcaagttgtctcttctatggcagaccaatactgt
aaatatgtgcatgcaagccaaggtatacattttcgtaagcccattcctgcgtgtaacgtc
gtattgtcttcactgctagagcgccaagatcacaacggttattctcaccagaacccgtct
ttcctaggcgccatgctagagaagcaccccaacattatctcggcttatttacccgcagat
gctaacagcaccttggtttacaccgaacgtgcttatggagatcgcgataaactcaacatt
atcgtcgccggaaagaaatcgctaccccagtggttatcgctggatgaagcccgcaagcag
gccaaagatggcatcatggtgtgggattttgcctctgatgaaaacccagacgtggtactg
gctggttgtggtgattacgccactcaagaatgcatggcctcactagtactaatccgtgag
attttacccagagtgcgcatccgttttgtcagtgtgtcagaacttcacagcagcggctta
ggtagccttaagttccaaagcaagccttggatgatggatgaagtcttcaccgaagataaa
ggcgtggtatttaactatcatggctatccaaacaccatcaaaaagctagtatttgattat
aagggtaaccgtcgtttccgcatcaagggttatgaagaagaaggttcaacgactacaccc
tttgacatgggcgtgcgtaatggtacttcgcgctaccacttagttatcgatatggcttac
aagttgttccaacaaggggtgattgatgaaacgcaacacgttcgcatcactaccgatatg
ttacaacgtctggttgaccacaagaattacatcaaagccaacggcgtagatccagttgaa
atcgaaaactgggtatggactcgctaa

DBGET integrated database retrieval system