KEGG   Shewanella denitrificans: Sden_2735Help
Entry
Sden_2735         CDS       T00344                                 

Definition
(GenBank) glucose-6-phosphate isomerase
  KO
K01810  glucose-6-phosphate isomerase [EC:5.3.1.9]
Organism
sdn  Shewanella denitrificans
Pathway
sdn00010  Glycolysis / Gluconeogenesis
sdn00030  Pentose phosphate pathway
sdn00500  Starch and sucrose metabolism
sdn00520  Amino sugar and nucleotide sugar metabolism
sdn01100  Metabolic pathways
sdn01110  Biosynthesis of secondary metabolites
sdn01120  Microbial metabolism in diverse environments
sdn01130  Biosynthesis of antibiotics
sdn01200  Carbon metabolism
Module
sdn_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
Brite
KEGG Orthology (KO) [BR:sdn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sden_2735
   00030 Pentose phosphate pathway
    Sden_2735
   00500 Starch and sucrose metabolism
    Sden_2735
   00520 Amino sugar and nucleotide sugar metabolism
    Sden_2735
Enzymes [BR:sdn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.9  glucose-6-phosphate isomerase
     Sden_2735
Exosome [BR:sdn04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Sden_2735
  Exosomal proteins of other body fluids (saliva and urine)
   Sden_2735
  Exosomal proteins of colorectal cancer cells
   Sden_2735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGI
Motif
Other DBs
NCBI-ProteinID: ABE56014
JGI: Sden2735
UniProt: Q12KL2
Position
3277299..3278936
Genome map
AA seq 545 aa AA seqDB search
MTQLTQSSCWQALIADAAKLPHMRDLFAQNPQRFEQMSLNACGLFLDYSKNRADETTLKL
LFSLAKEAKLTEKIAAMFNGDIINTTEQRAVLHTALRSKACQDIRVDGVNIVPEVQQTLD
KMAQFVDSVQTGQCKGYTGKRITDIVSIGIGGSFLGPKIVSQALRPYWKAGLNCHFVANV
DASSICEKLKLLNAETTLFVMSSKSFGTQETLTNTLSAKDWFLDQGATQADIAKHFVAVT
SNVTKATEFGMDADNIFPMWDWVGGRYSLWSAIGLPIALLIGMDNFRLLLDGAHQMDEHV
KAAPLEQNMPVIMALLSVLYTNFHGAQSHVVLTYDHYLRGLPAYFQQLDMESNGKSVTLN
GTQVDYSTGPVIWGGEGTNGQHAYHQLLHQGTALIPADFIMPLQSHNPLGEHHAQLASNC
FGQTQALMQGRTFEEAMAELSQSSLNEADKTLIAKHKVMLGNKPSNTLLMDKLTPQTLGS
LIALYEHRTLVQGAIWQINSFDQWGVELGKQLGNDVLARIGAAHNATELDSSSNALINRF
RQGKI
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgacacaacttactcaaagcagctgctggcaggcccttattgccgatgcagccaagctg
cctcacatgcgagacttatttgctcaaaaccctcaaaggtttgagcagatgagcctgaac
gcctgtggtctttttttggactactcaaaaaaccgtgcggatgagaccacacttaaacta
ttattttcattagcgaaagaagcaaagcttacagaaaaaatagccgccatgtttaatggt
gacattattaataccactgagcagcgcgcagtattacataccgcccttcgcagtaaagcc
tgccaagatatacgcgtcgatggggttaatattgtcccagaagtgcagcaaaccttggat
aaaatggctcaatttgtggattcagtgcaaactggacaatgcaaaggctacacaggcaag
cgcatcactgacatagtcagcattggtattggtggctcattcttaggccctaagatagtc
tcacaagcgctacgcccttattggaaggccgggcttaattgccatttcgttgccaatgtc
gatgccagttcaatttgtgaaaaattaaagctgcttaatgctgaaaccactttgtttgtt
atgtcatcaaagtcttttggcactcaagaaaccttgaccaataccttaagcgctaaagat
tggttcttagaccaaggcgccactcaggctgatatcgctaagcacttcgttgctgtgacc
tcaaacgtcaccaaggccactgaatttggcatggacgcagacaatattttccctatgtgg
gactgggtcggtggtcgatattctctgtggtcagccataggattacctattgcgctatta
attggtatggacaatttccgtttgctgctcgatggcgcccatcaaatggatgagcacgtt
aaagccgcgccattagagcaaaacatgccagtcatcatggcgctgttgtctgtgctttat
actaatttccatggggctcagtctcatgtggtattgacctatgaccattatttacgtggg
ctccctgcctatttccagcaactcgatatggaaagcaatggtaaatcggtaaccttaaat
ggcactcaagtggattacagcacagggcctgtcatttggggcggtgaaggcaccaatggt
cagcacgcttaccaccaattgttgcatcaaggcacagcacttattcctgccgattttatt
atgccattgcaaagtcataatccgctgggcgaacaccatgcacaacttgcatctaactgt
tttggtcaaactcaagccctaatgcaaggtcgaaccttcgaagaggccatggcagagctt
tctcaaagctcacttaatgaagccgataaaaccctcatcgctaaacacaaggtgatgctg
ggcaacaagcctagtaacaccttgctgatggataagctaacgccgcaaaccttaggttcg
cttatcgcactctatgagcacagaaccttagtacaaggcgcgatttggcaaattaactca
ttcgatcagtggggtgttgagcttggaaagcagctcggcaatgatgtgctagctcgaatt
ggtgcggcgcacaatgccacagaactcgattcatccagcaatgcactgataaatcggttc
aggcaaggtaaaatttaa

DBGET integrated database retrieval system