KEGG   Shewanella denitrificans: Sden_2738Help
Entry
Sden_2738         CDS       T00344                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sdn  Shewanella denitrificans
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sdn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sden_2738
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sden_2738
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Sden_2738
Enzymes [BR:sdn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Sden_2738
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3280188..3281468)
Genome map
AA seq 426 aa AA seqDB search
MELYNLKHVSERVNFSQALQLGLGKDRGLFFPSQIPKLDDMDAILALPFVARCKTILGAW
LSDELGQNQVDMLVEQAFNFSLPLTRVDDNRACLELFHGPTLAFKDFGARFMAQCISALA
EDKRLTILTATSGDTGAAVADAFFGLDKVQVVVLYPKGKISLLQEKMFTTLGENIHTIAV
ESDFDACQELVKQSFEDNELRQTLGLNSANSINISRLLAQICYYFEAVAQVRQYSDKDIV
VSVPSGNFGNLTAGLFAKAMGLPIARFIAATNSNDTVPRYLVNGQWVPHTTVATLSNAMD
VSEPSNWPRVEAICAAMGWPLSVISGVMVDEVQTAASLTSLASLGYQSEPHASIAAQGLV
TLKEHETGIFLGTAHPAKFKDVVDSILGTDLALPQALRAVEAKTILSRPLAADFGLLKSH
LLQKLA
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggaattatataatttaaagcatgtgtcggagcgagtaaatttcagtcaagccttgcag
ttgggattaggtaaggacagagggctatttttcccaagccagatccccaaacttgatgac
atggacgccatcttagcgctgccttttgtcgcccgttgtaagacaatcctcggcgcttgg
ctcagtgatgagttaggtcaaaatcaggttgatatgttagtggagcaggcgtttaatttc
tcactgcctttgactcgtgtggatgacaatagggcctgtctcgaactttttcatggtcca
accttggcctttaaagatttcggcgctcgttttatggctcagtgcattagcgccttagcc
gaagataaacgtctgaccattttaaccgcgacatcaggtgacactggggccgcggtggcc
gatgcatttttcggcctagataaggtacaagtggtggtactttatcctaagggcaaaata
agtctgctgcaggagaagatgtttactaccttaggcgaaaatatccacactatagcggta
gagtctgactttgatgcttgtcaggaactggttaaacaatcttttgaggataatgaactt
aggcaaacgttagggcttaattctgccaattctatcaatatcagccgtttgttggcgcag
atttgttattactttgaagctgtcgctcaagtaaggcaatacagcgataaagacatcgtt
gtctcagtgcccagtggcaattttggtaatttaaccgcagggctatttgccaaggccatg
ggcttacccatagcgcgctttattgctgccactaacagcaacgatactgtgcctcgttat
cttgttaatggtcaatgggtccctcataccacggttgccaccttatccaatgcgatggac
gtctcagagccaagtaattggccaagagttgaggcgatatgtgcagcgatgggctggccg
ttaagtgtgataagcggtgttatggtggatgaagtccaaacagcagcatcactgacctct
ctggcaagcttaggctaccaatcagagccccacgccagtattgctgctcaggggctggtt
acgcttaaggaacatgaaaccggcatatttttaggtacggcccatccggctaaatttaag
gatgtagtcgacagcatattgggcacagacttagccttgcctcaagccttacgcgccgtg
gaagctaaaactatcctttctaggccccttgcagcggactttggtctgcttaaatctcat
ttgctgcaaaaactagcctaa

DBGET integrated database retrieval system