KEGG   Shewanella denitrificans: Sden_2827Help
Entry
Sden_2827         CDS       T00344                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
sdn  Shewanella denitrificans
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sdn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Sden_2827
Enzymes [BR:sdn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Sden_2827
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3376795..3377295)
Genome map
AA seq 166 aa AA seqDB search
MARIYISLGTNVEPERHVIAGVADLQRHLGALQLSRVFESEAVGFNGTNFLNMVIGAETE
LSIAEVNALFKQIEQDNGRQVQAKKFSPRSLDLDLLLYDDAVCQLPIVLPRGEILYNAFV
LWPLAELIPNELHPLVKKTYLSLWDEFDKQSQHIWPIAFDFPQPEP
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtatttatattagtttaggcaccaatgttgagcctgaacgccatgttattgct
ggggttgccgatttgcagcgccatttaggagcgttgcaattatctcgggtatttgagagt
gaggccgtgggatttaatggcactaactttttaaatatggtcataggcgcagagactgag
ctttcaatcgccgaagtgaacgctttattcaagcaaatagagcaagacaatggcaggcaa
gtgcaggcgaagaagtttagccctcgcagtttagatcttgatttactcctctatgatgat
gcagtttgtcagttgcctattgtattgcctcgcggtgaaatcctatataatgccttcgtg
ctctggcctttagctgaacttatccccaatgaacttcatccgctggtgaaaaagacttat
ttaagtctgtgggatgaatttgataagcagagtcagcacatttggcctatcgcttttgat
tttccacagcccgagccgtaa

DBGET integrated database retrieval system