KEGG   Shewanella denitrificans: Sden_2976Help
Entry
Sden_2976         CDS       T00344                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
sdn  Shewanella denitrificans
Pathway
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sdn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Sden_2976
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Sden_2976
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Sden_2976
Enzymes [BR:sdn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Sden_2976
Exosome [BR:sdn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sden_2976
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3561713..3563098
Genome map
AA seq 461 aa AA seqDB search
MRLTSLLSLLTGVAIAITAVAAVPANALEVFTASESNVPNAGPARPKNIIIMIGDGMGPA
YPTAYRYFKDNPDTQEIEQTVFDRLLVGMASTYPERSSGYVTDSAAAATALATGFKSYNG
AISVDINKQPLTTLMEHAKSLGMATGIAVTSQVNHATPAAFLTHNESRKNYLDIAQSYLA
TGTDVILGGGQDYFSQDLLAQFVAKGYEYATDKKSLAKAKSPKVIGLFAPVQLPWAVNNK
EGLQLSQLTKKALSLLSQQEQGFVLLVEGSLIDWAGHSNDIVSAMGEMQEFAASIEVAEQ
FARQNKDTLVIITADHNTGGLSIGANGEYAWHPEVIKNVKASPDSIAKQLIDTEAWLSSF
TQLVGFEPLDSEWSLLLKAKEKGLDDFTLAISRLIDKRSGTGWTTFGHTALDVPVYATGP
GAKLFFGFQDNTDIANKIFSLLPKPEMIQDTPDKGAPVSEL
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgcgccttacatcactacttagcctgctgaccggcgttgcaattgccatcacagctgtg
gctgccgttcccgccaatgctttagaagtatttaccgcctcagagtccaatgtgccaaat
gcaggccctgcaaggccaaaaaatatcatcattatgattggcgatggcatgggcccagcc
taccccacagcttatcggtattttaaggataatcctgacactcaagaaattgagcaaacc
gtgtttgatcgtcttttagtcggcatggccagtacttatccagaaagaagcagcggctat
gtcacagattctgcagccgcggcaacggcattggccaccggctttaaaagctacaatggt
gctatttcagtggacatcaataagcaaccactgaccaccctaatggaacacgccaaatca
ctcggtatggcgacgggcattgctgtcacaagccaagtgaaccacgcgacgccagcagcc
ttcttaacccataacgaaagtagaaaaaactatcttgatatcgcgcagtcctaccttgca
acaggtacggatgttattttaggtggcggacaagattatttctcccaagacttattggca
caatttgtcgctaaaggctatgaatatgccacggataaaaaaagtttagccaaggcaaaa
agccctaaagtcatcggcttatttgcaccggttcaattgccttgggccgtgaataataaa
gagggtctgcaactgagtcagctcaccaagaaggcgttaagcttactgtcgcagcaagaa
caaggattcgtattattagtagaaggcagccttatcgactgggctggacacagtaatgat
atcgtctctgccatgggtgaaatgcaagagtttgccgccagtatcgaagtggccgaacaa
tttgccagacaaaacaaagacaccttggttatcatcactgccgaccacaatactggcggc
ctctcaattggcgctaacggtgagtatgcatggcatcctgaggtcataaaaaatgtcaaa
gcgagccctgatagtattgctaaacaattaattgatactgaggcttggttgagctcattt
acgcaacttgtgggctttgagccgctagactctgaatggtcattattattaaaagccaaa
gaaaagggtttagatgatttcaccttggccattagccgacttatcgataaacgctcaggg
acgggctggactacctttggccacacagccttagatgtgcccgtttatgccacggggcct
ggtgctaaattatttttcggctttcaagataataccgacattgccaataaaatttttagt
cttttacctaagccagaaatgatccaagacacaccagacaagggcgcaccagtcagtgag
ctctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system