KEGG   Shewanella denitrificans: Sden_3669Help
Entry
Sden_3669         CDS       T00344                                 

Definition
(GenBank) alpha/beta hydrolase fold
  KO
K01048  lysophospholipase [EC:3.1.1.5]
Organism
sdn  Shewanella denitrificans
Pathway
sdn00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:sdn00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Sden_3669
Enzymes [BR:sdn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Sden_3669
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 LIDHydrolase Abhydrolase_5 Peptidase_S9 LCAT Lipase_3 PGAP1 Esterase DUF3089 DLH DUF900 Ser_hydrolase DUF915
Motif
Other DBs
NCBI-ProteinID: ABE56944
JGI: Sden3669
UniProt: Q12HY2
Position
4385575..4386564
Genome map
AA seq 329 aa AA seqDB search
MVSMIKTAQGYSSELTRDQSELTQFWSQVQQESLAIEPGITLAYGFIRHEDNRRAIVISN
GRVESYLKYQELIYDCYQQGFSVYALDHRGQGLSSRLTTNPHQGHVEHFSDYVDDFKVFI
ERVVKPERHKELFLVGHSMGGAIATHYIHQDPTTFNAAVLSAPMYGIILPLPTVVIKQLA
TKMINTQPVIGSHLVATNYIIGGRDYQAISFKLNQLTHSQVRYQHYRDLYQQQPQCQLGS
PTNQWLAEAIDAAKASIDMARGSPIPLLILQAGKDKIVCNQAQNKALAGLCQRIIIEGAF
HEVFIETDKLRDKALKALFDFINQHSEII
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggtgagtatgataaagacagcccaaggttattcttcagaactgactcgagatcagtca
gagttaacacaattttggtcacaggtgcagcaggaaagtttagccattgagcctgggatc
accttggcctatggatttatcagacatgaagacaatcgccgcgccattgtgattagcaat
ggccgagtcgagtcctaccttaagtatcaggagttaatttacgactgctatcagcaaggc
tttagtgtgtatgcactcgatcaccgaggccaaggcttgtccagccgcttaaccaccaat
ccccaccaagggcatgtggagcatttttctgattatgtagatgattttaaagtatttatc
gaacgcgtggtaaaaccagagcgacacaaggagttatttcttgtcggccactccatgggc
ggtgccattgcgactcactatatacaccaagatccaacgacctttaacgcagcagtctta
tcggcgcccatgtacggcattatactgccccttccgactgtcgttattaagcaactagca
accaagatgataaacactcagcctgtcataggcagccacttagtcgctacaaactacatt
attggcgggcgggattatcaagccattagctttaaactgaatcaactcacccatagccag
gtacgttaccagcattatcgtgatttataccaacaacaaccccaatgccagctcgggtct
ccaaccaaccagtggttagcagaggccattgatgccgctaaggcgagtattgatatggcc
agaggaagcccgatccctttgctcatcttgcaagcggggaaagataagatagtctgtaat
caggcgcaaaataaagcgcttgcagggctttgccagcggatcattatcgaaggcgctttc
catgaagtgtttatcgaaactgataaactcagagataaagcgctaaaggcactgttcgat
tttattaaccaacactcagagataatttag

DBGET integrated database retrieval system