KEGG   Shewanella denitrificans: Sden_3669Help
Entry
Sden_3669         CDS       T00344                                 

Definition
alpha/beta hydrolase fold
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
sdn  Shewanella denitrificans
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:sdn00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4385575..4386564
Genome map
AA seq 329 aa AA seqDB search
MVSMIKTAQGYSSELTRDQSELTQFWSQVQQESLAIEPGITLAYGFIRHEDNRRAIVISN
GRVESYLKYQELIYDCYQQGFSVYALDHRGQGLSSRLTTNPHQGHVEHFSDYVDDFKVFI
ERVVKPERHKELFLVGHSMGGAIATHYIHQDPTTFNAAVLSAPMYGIILPLPTVVIKQLA
TKMINTQPVIGSHLVATNYIIGGRDYQAISFKLNQLTHSQVRYQHYRDLYQQQPQCQLGS
PTNQWLAEAIDAAKASIDMARGSPIPLLILQAGKDKIVCNQAQNKALAGLCQRIIIEGAF
HEVFIETDKLRDKALKALFDFINQHSEII
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggtgagtatgataaagacagcccaaggttattcttcagaactgactcgagatcagtca
gagttaacacaattttggtcacaggtgcagcaggaaagtttagccattgagcctgggatc
accttggcctatggatttatcagacatgaagacaatcgccgcgccattgtgattagcaat
ggccgagtcgagtcctaccttaagtatcaggagttaatttacgactgctatcagcaaggc
tttagtgtgtatgcactcgatcaccgaggccaaggcttgtccagccgcttaaccaccaat
ccccaccaagggcatgtggagcatttttctgattatgtagatgattttaaagtatttatc
gaacgcgtggtaaaaccagagcgacacaaggagttatttcttgtcggccactccatgggc
ggtgccattgcgactcactatatacaccaagatccaacgacctttaacgcagcagtctta
tcggcgcccatgtacggcattatactgccccttccgactgtcgttattaagcaactagca
accaagatgataaacactcagcctgtcataggcagccacttagtcgctacaaactacatt
attggcgggcgggattatcaagccattagctttaaactgaatcaactcacccatagccag
gtacgttaccagcattatcgtgatttataccaacaacaaccccaatgccagctcgggtct
ccaaccaaccagtggttagcagaggccattgatgccgctaaggcgagtattgatatggcc
agaggaagcccgatccctttgctcatcttgcaagcggggaaagataagatagtctgtaat
caggcgcaaaataaagcgcttgcagggctttgccagcggatcattatcgaaggcgctttc
catgaagtgtttatcgaaactgataaactcagagataaagcgctaaaggcactgttcgat
tttattaaccaacactcagagataatttag

DBGET integrated database retrieval system