KEGG   Streptococcus dysgalactiae subsp. equisimilis 167: SDSE167_0351Help
Entry
SDSE167_0351      CDS       T02870                                 

Gene name
amyE
Definition
alpha-amylase (EC:3.2.1.1)
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
sdq  Streptococcus dysgalactiae subsp. equisimilis 167
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sdq00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SDSE167_0351 (amyE)
Enzymes [BR:sdq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     SDSE167_0351 (amyE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
304466..305752
Genome map
AA seq 428 aa AA seqDB search
MVAQKTKGLFTKLSIAGLIFGLSNTSLVPLISTQVVSAESNQIAMKDGAILHAWCWSFNT
IKQNMKAIKDADYTSIQTSPINAVMPGDNGSKDLKNWYFHYQPTDYTIGNYQLGTEDEFK
AMAAEADKYGINIIVDAVLNHTTTDINAVSEKIKAIPDWTHGNQGITNDYDRYQVTQHAL
LGLYDLNTQNKAVQEYLLNYLKQAVADGADGFRFDAAKHIELPGEFNSDFWTNILANSGA
KFQYGEVLQGAASRESDYGKLMGVTASHYGEFIRKVIGQGYVKDGDLVNYQVPGVSEDNL
ITWIESHDNYANDSEESTKLTDQDIILGWSIIGARKEGAPLFFSRPVGGGGQHGRFPGTT
KIGDAGSDLFKDPTIVAINKFRNAMNGQSEYTRNPNMDQGLVMIERGGKGAVITNLTSEE
KEFIPKQR
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggtagcacaaaagacaaaagggctgtttactaaattatcaatagcagggttaatcttt
ggtttatctaatactagtctagttccattaatatcaacacaggttgtcagcgctgaatca
aaccaaattgccatgaaagatggcgctatccttcatgcatggtgttggtcctttaacacc
ataaaacaaaacatgaaagctatcaaggatgctgactatacaagtatccaaacgtcaccg
attaacgcagtgatgcctggggataacggtagcaaagatttgaaaaattggtattttcat
taccaacccactgattacacaattggcaattatcagttgggaaccgaagatgagtttaaa
gccatggcagcagaagctgataaatacggtattaatattattgtggatgcggttttaaat
catacaactacagatatcaatgctgtgagtgaaaaaattaaggctatcccagattggact
cacgggaatcaaggaataactaatgactacgaccgatatcaagtgactcaacatgcttta
ttgggtctttatgatttaaatacgcagaataaagctgtccaagaataccttcttaattat
ttaaaacaagctgtagcagatggggcagatggttttaggtttgacgcagcgaagcatatt
gaactgccgggagagtttaatagtgatttttggactaatatcttagctaacagtggcgct
aaattccaatatggtgaggtcttgcaaggagctgcctcaagagaaagcgactatggtaag
ttgatgggagtgacggcttctcattatggtgaatttattcggaaagttataggacaaggt
tatgtaaaagatggagatttagtgaactatcaagtacctggggtttcggaagacaatttg
attacctggatagaatcacatgataattacgcgaatgatagtgaagaatcaacaaagttg
actgaccaagatattatcttaggatggagtattattggagctagaaaagaaggcgcgcca
ctctttttctcacggccagtgggtggaggtggtcaacatggacgcttcccaggaacaact
aaaattggtgatgctggaagcgatctctttaaagatccaacgattgttgcgatcaataaa
ttccgcaatgctatgaatggtcaatctgaatacacccgaaatcctaatatggaccaagga
cttgtgatgattgaacgtggtggtaaaggagctgttataactaatttaaccagcgaagaa
aaagaattcattccgaaacaacgttag

DBGET integrated database retrieval system