KEGG   Streptococcus dysgalactiae subsp. equisimilis 167: SDSE167_0583Help
Entry
SDSE167_0583      CDS       T02870                                 

Gene name
fpg
Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
sdq  Streptococcus dysgalactiae subsp. equisimilis 167
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:sdq03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
511619..512446
Genome map
AA seq 275 aa AA seqDB search
MPELPEVETVRRGLESLVLGQEIVAVKVEVPKMVKSDLRIFLQTLPGQTIQTIGRRGKYL
VFDFGQTVLVSHLRMEGKYLLFPDEVPEQKHFHVFFTLKNGSTLVYQDVRKFGTFDLIPK
SQLSDFFAQRKLGPEPKKETFKLKPFEVALQSSKKLIKPYLLDQTLVAGLGNIYVDEVLW
AAKVHPERLSFSLKKAEIKRLHDETIRILQLGIEKGGSTVRTYRNALGADGTMQHYLQVY
GQAGKPCPRCGQAISKLKVGGRGTHICPKCQKKRS
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgccagaattaccagaagttgaaacggttcgacgaggactcgagtctttagtgctaggt
caggaaattgttgctgtcaaggtagaagtgcctaagatggtcaagtcggatttgaggatt
tttcttcagacattacctggccaaaccattcaaaccattggtcggcggggtaaatattta
gtgtttgatttcggtcagacggtccttgtgtcacatctacgcatggaaggtaagtatttg
ctttttccagatgaggtgcctgaacagaaacattttcatgttttctttaccttaaaaaat
ggatcgaccttagtgtatcaagacgtgcgtaaatttgggacctttgatcttattcctaaa
tcccaattgtcagatttttttgcccaacgaaaacttggtccagaaccaaagaaagagacc
tttaaacttaaaccgtttgaagttgctctgcaatcttccaaaaaactaatcaagccctat
cttttggatcagacgcttgttgctggtttaggaaatatttatgttgatgaagtactctgg
gcagctaaagttcaccctgagcgtctctcttttagtttaaaaaaggcggagataaaacgg
ctacatgatgaaaccattcgtatcttgcagctagggattgaaaaaggtggttcaactgtt
cggacctatcgaaatgctttaggagcggatgggacgatgcagcattatttgcaggtgtat
ggccaagcaggaaaaccttgcccacgttgtggtcaggctattagtaaactaaaagttgga
ggaagggggacacacatttgtccgaaatgtcagaaaaaaaggtcctaa

DBGET integrated database retrieval system