KEGG   Streptococcus dysgalactiae subsp. equisimilis 167: SDSE167_0599Help
Entry
SDSE167_0599      CDS       T02870                                 

Gene name
amyS
Definition
alpha-amylase (EC:3.2.1.1)
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
sdq  Streptococcus dysgalactiae subsp. equisimilis 167
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sdq00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
528840..530303
Genome map
AA seq 487 aa AA seqDB search
MTNQLIMQAFEWYLPADGNHWKTVKASIPQLQHLGVTELWLPPAFKGTGINDVGYGVYDL
FDLGEFDQNGTVITKYGSKQEYLDLITALKEAAIKPIADIVLNHKANGDHKERFFVIKMN
PENRQEALTEPYEIEGWTGFDFPGRNGCYNDFKWHWYHFTGLDYDAKNNETGIYMITGDN
KGWANNDLIDDEHGNFDYLMYNDLDFKHPEVIQNLQDWAKWFIETTGIEGFRLDAVKHID
SYFIQTFVNDIRTQIKPDLEVFGEYWKSDQDSMEDYLEATNEQFALVDVGLHMSFFNASH
QGKDFDLTHIFEGSLVASRPDLAITFVENHDTQRGQALESTVEDWFKPLAYGLILLRQEG
KPCLFYGDYYGISGDFAQASFKEVLDKMTLLRKEAVYGEQVDYFDHANCIAWTCLGDEEH
PHPLAVILSNGDEGWKHVEIGQDFVGQTFVDYLGYCSEKVVVAEDGWLDIKVEAGSISAW
VPEERSF
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatcaactaatcatgcaggcttttgagtggtatcttcctgcagatggtaaccac
tggaaaacagtgaaagcaagtattccacaattacagcatttaggagtgactgagctctgg
cttcctcctgcttttaaaggaactggtattaatgatgtgggatatggtgtttatgattta
tttgacctaggggaatttgatcaaaatggcacagtcattaccaaatacggtagtaaacaa
gaatatctcgaccttattacagctttgaaagaagctgccatcaaaccaatcgcagatatt
gttcttaaccataaagccaatggagatcataaggaacgtttttttgtcatcaaaatgaat
cctgaaaatcgccaggaagctctgacagaaccttatgagattgaaggttggactggtttt
gactttcctggtcgaaatggttgctataatgattttaaatggcattggtatcatttcaca
gggcttgattatgatgccaagaacaatgaaactggcatttacatgattacaggtgacaat
aagggctgggccaacaatgacttgattgatgacgaacatggtaattttgattacctcatg
tacaatgatttggacttcaaacacccagaggttattcaaaacttgcaggattgggctaag
tggtttattgagacaacaggaatcgaaggttttcgtctagatgccgtcaaacacattgat
tcttattttatccaaacctttgtcaatgatattcgcactcaaatcaaaccagatttagaa
gtttttggtgagtattggaagtcagaccaagactccatggaagactacttggaagccacc
aatgaacagtttgctttagtagatgtcggtcttcacatgtctttctttaacgccagtcat
caaggaaaggattttgatttaacacatatctttgaaggaagtttagtggctagcaggcct
gacttggctattacttttgttgaaaatcatgacacgcaacgtggtcaagctttggagtcc
acagtggaagattggtttaaacctctggcctacggcttaattctcttgcgccaagaaggc
aaaccttgtctgttctatggcgattactatggtatttccggagactttgctcaagctagt
tttaaagaagtgcttgacaagatgacgctgttgcgtaaagaggctgtttacggggaacaa
gtcgattattttgatcacgctaattgcattgcctggacttgtttaggcgatgaagaacat
ccccatccgctggcagttatcctatcaaatggtgatgaaggttggaagcatgtggaaatc
ggtcaagactttgtcgggcagacctttgtcgattacttaggctattgttcagaaaaggta
gtggtggctgaagatggttggcttgatattaaggtggaggcaggctctatttcagcctgg
gtacctgaagaaagaagcttttaa

DBGET integrated database retrieval system