KEGG   Streptococcus dysgalactiae subsp. equisimilis 167: SDSE167_0914Help
Entry
SDSE167_0914      CDS       T02870                                 

Definition
class II aldolase/adducin
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
sdq  Streptococcus dysgalactiae subsp. equisimilis 167
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:sdq00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
838377..839114
Genome map
AA seq 245 aa AA seqDB search
MTNGKILFEEERRTLAEAVKLTYYRKNTNTAGGNFSFLTEAKNGKKYIIMTPSLMSEVYH
GLVSPSQILVVDLESGELVAGDGKVTREINLHFACYQSNPDIKCVFHAHAPNAMFWATSH
LDMPNVTEATQKVKHIKVLDFAPNTTVELAEIVRKEVESDLSLPKEYLLDSHGVLILTPG
KDGIEALNKALQIIDTVEWNAEIAYKQTIFQRLGLLDGYYSKGKKIATIDDLMVNPIYSS
DDGLE
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatggtaaaatcttatttgaagaagaacgaagaactttagctgaagcagtaaaa
ttaacctactacagaaagaatacaaatacagcgggaggtaacttttcatttttaacagaa
gctaaaaatgggaaaaaatatattatcatgactccttcgcttatgtcagaagtttatcat
ggcttagtatctccttctcaaattcttgttgttgacttggaatcgggagaattagtagct
ggtgatggaaaagtcacacgtgaaattaaccttcattttgcatgttatcaatctaatcca
gatattaaatgtgtttttcatgcacatgcaccaaatgcgatgttttgggcaacaagtcat
ttagatatgcctaacgtcactgaagcaacccaaaaagttaagcatattaaagtccttgac
tttgctccaaacacaactgttgaacttgcagagattgttcgaaaagaagttgaatctgat
ttaagcctaccaaaagaatatcttttggatagtcatggtgtattgattctaactccagga
aaagatggtattgaagcattgaataaggccttgcagattattgatactgttgaatggaat
gctgaaattgcttataaacaaacaatttttcaaagattgggacttttggatggttactat
tcaaaaggtaaaaaaattgcaactattgatgacttaatggttaacccaatttatagtagt
gatgacggtttggaataa

DBGET integrated database retrieval system