KEGG   Sulfuricella denitrificans: SCD_n01127Help
Entry
SCD_n01127        CDS       T02857                                 

Definition
class I and II aminotransferase (EC:2.6.1.-)
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
sdr  Sulfuricella denitrificans
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:sdr01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:sdr01230]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:sdr00250]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine biosynthesis [PATH:sdr00290]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1134736..1135962
Genome map
AA seq 408 aa AA seqDB search
MQPVLKSSKLANVCYDIRGPVMARARQMEEDGHRIIKLNIGNTAPFGFEVPEEILQDVIH
NLPNASGYCESKGLFAARKAIMHYTQEKKIADVTMEDIYIGNGVSELIVMAMQGLLNTGD
EVLVPMPDYPLWTAAVTLAGGTPHHYICDEQSGWLPDLNDIRGKIGPNTRAIVLINPNNP
TGALYPVELLREVVEIARQHQLIIYSDEIYDKVLYDGATHTSIASLADDVLFITFNGLSK
NYRAAGYRAGWLVVSGEKKHARDYIEGLTMLASMRLCSNVPAQYGIQTALGGYQSINDLV
APGGRLTKQRDLAYQLLTDIPGVTCVKPQGAMYLFPRLDAKMYPIADDQEFILELLLEEK
VLLVQGSGFNWPNPDHFRVVFLPNVDDLTEAIGRIAHFLEHYRKRHGS
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgcaacccgtactcaaatccagcaagctcgccaacgtctgctacgacatccgtggaccg
gtgatggcgcgtgcccggcagatggaggaggacgggcatcgcattatcaaactcaacatc
ggcaatacggcaccgttcggttttgaagtgccggaggaaatcctgcaggatgtgatccat
aatctgcccaatgcctccgggtattgcgaatccaaagggctgttcgccgcgcgcaaggcg
atcatgcactacacccaggaaaagaaaatcgccgatgtgacgatggaggatatctacatc
ggcaacggcgtgtccgagctgatcgtgatggcgatgcagggtttgctgaacactggagat
gaagtactggtgccgatgcctgactatccgctgtggacagcggcggtaacactggccggc
ggcacgccccaccattacatctgcgacgagcagtctggctggctgccagatctgaacgat
attcgcggcaaaatcgggccaaatacccgtgcgattgttctgatcaacccgaataatccg
accggtgcgctttatccggttgaactgctgcgagaggtcgtggagatcgcgcgacaacac
cagctgatcatctactccgacgagatctacgacaaggtcttgtatgacggtgcgacccat
acctcgattgcgtctctggcagacgacgtgctgttcattaccttcaacggactttccaag
aattaccgtgcagccggttatcgtgcgggatggctggtggtgtcgggcgaaaaaaagcat
gccagagattacattgaaggcttaaccatgctcgcctcgatgcgattgtgttccaacgtg
ccggcgcagtacggaatacagactgcacttggcggctaccagagcatcaatgatctggtc
gcgcccggggggcgtctgaccaagcaacgcgacctggcctatcagttgctcaccgatatt
cccggtgtaacctgcgtcaagccgcagggcgccatgtatttgttcccccggcttgatgcc
aagatgtacccgattgccgatgaccaggaattcatccttgagttgctgcttgaggaaaag
gtgttgctggtgcagggcagcggtttcaactggccaaaccccgatcatttccgggtggtg
ttcctgcccaacgtagacgacctcaccgaggccataggtcgtattgcacactttcttgag
cactatcgcaagcggcatggttcctaa

DBGET integrated database retrieval system