KEGG   Sulfuricella denitrificans: SCD_n01127Help
Entry
SCD_n01127        CDS       T02857                                 

Definition
class I and II aminotransferase (EC:2.6.1.-)
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
sdr  Sulfuricella denitrificans
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sdr00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    SCD_n01127
   01230 Biosynthesis of amino acids
    SCD_n01127
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SCD_n01127
   00290 Valine, leucine and isoleucine biosynthesis
    SCD_n01127
Enzymes [BR:sdr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     SCD_n01127
    2.6.1.66  valine---pyruvate transaminase
     SCD_n01127
Amino acid related enzymes [BR:sdr01007]
 Aminotransferase (transaminase)
  Class I
   SCD_n01127
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1134736..1135962
Genome map
AA seq 408 aa AA seqDB search
MQPVLKSSKLANVCYDIRGPVMARARQMEEDGHRIIKLNIGNTAPFGFEVPEEILQDVIH
NLPNASGYCESKGLFAARKAIMHYTQEKKIADVTMEDIYIGNGVSELIVMAMQGLLNTGD
EVLVPMPDYPLWTAAVTLAGGTPHHYICDEQSGWLPDLNDIRGKIGPNTRAIVLINPNNP
TGALYPVELLREVVEIARQHQLIIYSDEIYDKVLYDGATHTSIASLADDVLFITFNGLSK
NYRAAGYRAGWLVVSGEKKHARDYIEGLTMLASMRLCSNVPAQYGIQTALGGYQSINDLV
APGGRLTKQRDLAYQLLTDIPGVTCVKPQGAMYLFPRLDAKMYPIADDQEFILELLLEEK
VLLVQGSGFNWPNPDHFRVVFLPNVDDLTEAIGRIAHFLEHYRKRHGS
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgcaacccgtactcaaatccagcaagctcgccaacgtctgctacgacatccgtggaccg
gtgatggcgcgtgcccggcagatggaggaggacgggcatcgcattatcaaactcaacatc
ggcaatacggcaccgttcggttttgaagtgccggaggaaatcctgcaggatgtgatccat
aatctgcccaatgcctccgggtattgcgaatccaaagggctgttcgccgcgcgcaaggcg
atcatgcactacacccaggaaaagaaaatcgccgatgtgacgatggaggatatctacatc
ggcaacggcgtgtccgagctgatcgtgatggcgatgcagggtttgctgaacactggagat
gaagtactggtgccgatgcctgactatccgctgtggacagcggcggtaacactggccggc
ggcacgccccaccattacatctgcgacgagcagtctggctggctgccagatctgaacgat
attcgcggcaaaatcgggccaaatacccgtgcgattgttctgatcaacccgaataatccg
accggtgcgctttatccggttgaactgctgcgagaggtcgtggagatcgcgcgacaacac
cagctgatcatctactccgacgagatctacgacaaggtcttgtatgacggtgcgacccat
acctcgattgcgtctctggcagacgacgtgctgttcattaccttcaacggactttccaag
aattaccgtgcagccggttatcgtgcgggatggctggtggtgtcgggcgaaaaaaagcat
gccagagattacattgaaggcttaaccatgctcgcctcgatgcgattgtgttccaacgtg
ccggcgcagtacggaatacagactgcacttggcggctaccagagcatcaatgatctggtc
gcgcccggggggcgtctgaccaagcaacgcgacctggcctatcagttgctcaccgatatt
cccggtgtaacctgcgtcaagccgcagggcgccatgtatttgttcccccggcttgatgcc
aagatgtacccgattgccgatgaccaggaattcatccttgagttgctgcttgaggaaaag
gtgttgctggtgcagggcagcggtttcaactggccaaaccccgatcatttccgggtggtg
ttcctgcccaacgtagacgacctcaccgaggccataggtcgtattgcacactttcttgag
cactatcgcaagcggcatggttcctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system