KEGG   Sulfuricella denitrificans: SCD_n01127Help
Entry
SCD_n01127        CDS       T02857                                 

Definition
(GenBank) class I and II aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
sdr  Sulfuricella denitrificans
Pathway
sdr00220  Arginine biosynthesis
sdr00250  Alanine, aspartate and glutamate metabolism
sdr00290  Valine, leucine and isoleucine biosynthesis
sdr01100  Metabolic pathways
sdr01110  Biosynthesis of secondary metabolites
sdr01130  Biosynthesis of antibiotics
sdr01210  2-Oxocarboxylic acid metabolism
sdr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sdr00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SCD_n01127
   00290 Valine, leucine and isoleucine biosynthesis
    SCD_n01127
   00220 Arginine biosynthesis
    SCD_n01127
Enzymes [BR:sdr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     SCD_n01127
    2.6.1.66  valine---pyruvate transaminase
     SCD_n01127
Amino acid related enzymes [BR:sdr01007]
 Aminotransferase (transaminase)
  Class I
   SCD_n01127
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: BAN34961
UniProt: S6AG58
Position
1134736..1135962
Genome map
AA seq 408 aa AA seqDB search
MQPVLKSSKLANVCYDIRGPVMARARQMEEDGHRIIKLNIGNTAPFGFEVPEEILQDVIH
NLPNASGYCESKGLFAARKAIMHYTQEKKIADVTMEDIYIGNGVSELIVMAMQGLLNTGD
EVLVPMPDYPLWTAAVTLAGGTPHHYICDEQSGWLPDLNDIRGKIGPNTRAIVLINPNNP
TGALYPVELLREVVEIARQHQLIIYSDEIYDKVLYDGATHTSIASLADDVLFITFNGLSK
NYRAAGYRAGWLVVSGEKKHARDYIEGLTMLASMRLCSNVPAQYGIQTALGGYQSINDLV
APGGRLTKQRDLAYQLLTDIPGVTCVKPQGAMYLFPRLDAKMYPIADDQEFILELLLEEK
VLLVQGSGFNWPNPDHFRVVFLPNVDDLTEAIGRIAHFLEHYRKRHGS
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgcaacccgtactcaaatccagcaagctcgccaacgtctgctacgacatccgtggaccg
gtgatggcgcgtgcccggcagatggaggaggacgggcatcgcattatcaaactcaacatc
ggcaatacggcaccgttcggttttgaagtgccggaggaaatcctgcaggatgtgatccat
aatctgcccaatgcctccgggtattgcgaatccaaagggctgttcgccgcgcgcaaggcg
atcatgcactacacccaggaaaagaaaatcgccgatgtgacgatggaggatatctacatc
ggcaacggcgtgtccgagctgatcgtgatggcgatgcagggtttgctgaacactggagat
gaagtactggtgccgatgcctgactatccgctgtggacagcggcggtaacactggccggc
ggcacgccccaccattacatctgcgacgagcagtctggctggctgccagatctgaacgat
attcgcggcaaaatcgggccaaatacccgtgcgattgttctgatcaacccgaataatccg
accggtgcgctttatccggttgaactgctgcgagaggtcgtggagatcgcgcgacaacac
cagctgatcatctactccgacgagatctacgacaaggtcttgtatgacggtgcgacccat
acctcgattgcgtctctggcagacgacgtgctgttcattaccttcaacggactttccaag
aattaccgtgcagccggttatcgtgcgggatggctggtggtgtcgggcgaaaaaaagcat
gccagagattacattgaaggcttaaccatgctcgcctcgatgcgattgtgttccaacgtg
ccggcgcagtacggaatacagactgcacttggcggctaccagagcatcaatgatctggtc
gcgcccggggggcgtctgaccaagcaacgcgacctggcctatcagttgctcaccgatatt
cccggtgtaacctgcgtcaagccgcagggcgccatgtatttgttcccccggcttgatgcc
aagatgtacccgattgccgatgaccaggaattcatccttgagttgctgcttgaggaaaag
gtgttgctggtgcagggcagcggtttcaactggccaaaccccgatcatttccgggtggtg
ttcctgcccaacgtagacgacctcaccgaggccataggtcgtattgcacactttcttgag
cactatcgcaagcggcatggttcctaa

DBGET integrated database retrieval system