KEGG   Sulfuricella denitrificans: SCD_n01926Help
Entry
SCD_n01926        CDS       T02857                                 

Definition
1,4-alpha-glucan branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
sdr  Sulfuricella denitrificans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:sdr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SCD_n01926
Enzymes [BR:sdr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     SCD_n01926
Exosome [BR:sdr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SCD_n01926
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1956063..1958231
Genome map
AA seq 722 aa AA seqDB search
MKVNPQVKSLLQARLHDPFAFLGTHQANGRWTVRVFAPYSEKLWLQIGDAWEDMQKTDSH
GLFEWNGKEAPHTPCHLRHLQNGVLKNSHDTYSFPSTISEHDLFLFGEGRLYQGYHMLGA
QPMENLGIAGVRFAVWAPNAERVSVVGDFNCWDGRVHTMRSLGSSGVWEIFIPGLSPGSL
YKFEIRNRHSGQVLVKADPYAREFELRPNTAARITASAGHAWQDGAWLEKRKNLDWLHAP
FNIYEIHAGSWRRHPDGRFYTWRELAESLVPYVKEMGYTHIELLPISEHPLDESWGYQTT
GYFAPTSRHGTPDELRAFIDACHQADIGVILDWVPAHFPQDAWALANYDGTALYEHEDPR
LGLHIDWGTHIFNFGRHEVKGFLLSSAHYWLDEFHFDGLRVDAVASMLYLDYSRKAGEWL
PNKYGGRENLEAIDFLRQLNIMVHDEFPGALTFAEESTSWPMVSRPVYLGGLGFSMKWNM
GWMNDTLTYMQNDPVHRRYHHNELTFGQLYAYTENFVLPFSHDEVVHGKRSLLAKMPGDG
WQKFANLRLLFTYQMTYPGKKLNFMGNELAQGREWRIGGELDWELLEREQHQGMKSLSRD
LNRLYRDRPALHELDFTSNGFAWIDCHDADQSVLSYLRRDRNGSFVAVMLNFTPVPRLGY
RIGVPRPGLYREILNSDSLFYGGSNQGNGEGAVAENTPWMGHPYSIVITVPPLAGIILAL
AE
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaaatccgcaggtgaagtctttgcttcaagctcggctgcacgatcctttcgcc
ttcctcggcactcatcaagccaacggaaggtggacagtccgggtatttgcaccctactcc
gaaaaactctggctacagatcggagatgcttgggaggatatgcaaaaaaccgactcgcat
ggcctgttcgagtggaacggcaaggaagcgcctcacacgccgtgccacctgcgccacctg
caaaacggggtactgaaaaacagccacgacacctattccttccccagcaccatcagcgag
cacgacctctttcttttcggcgaaggccggctctaccagggctaccacatgctgggtgca
cagccgatggaaaatctcggcatcgcgggcgtgcgcttcgcggtgtgggcacccaatgcg
gaaagagtcagcgtggtcggcgacttcaactgctgggacggtcgcgttcacaccatgcgc
agcctgggaagctcgggcgtgtgggaaattttcatccccggactttctcccggcagcctg
tacaaattcgaaatccgtaatcgccacagcggccaggtgctggtcaaggccgatccctac
gccagagaattcgaactgcgcccaaacaccgccgcccgcattacggcatctgcaggccat
gcctggcaggacggcgcatggctggaaaaacgcaagaacctcgactggctgcacgcgccg
ttcaacatctacgaaatccatgccggctcatggcggcgtcatcctgacgggcgcttctat
acctggcgcgaactggccgaaagtctggtcccttacgtcaaggaaatgggttacacccac
atcgaactgctaccgatttccgagcatcccctggacgagtcctggggctatcaaaccacc
ggctatttcgccccgacttcccgccacggcacgccggacgaactgcgcgcattcatcgac
gcctgccaccaggcggacatcggcgtcatcctcgactgggtgccggcgcacttcccgcag
gatgcctgggcgcttgccaactatgacggcaccgccctgtacgagcacgaagatccgcgc
ctgggcctgcatatcgactggggcacccacatcttcaatttcggccgccacgaggtaaaa
ggttttttgctgtccagcgcccattactggctggatgagttccacttcgatggcctgcgc
gtggatgccgtcgcttccatgctctacctcgactattcgcgcaaggccggcgaatggctg
ccgaacaagtacggcggacgggaaaacctcgaagctatcgacttcctgcgccagctcaac
atcatggtgcacgacgaattccccggcgcactcaccttcgccgaggaatccacctcctgg
cctatggtatcgcgcccggtttacctcggtggcctgggtttctcgatgaagtggaacatg
ggctggatgaacgacaccctgacctacatgcagaacgacccggtgcaccgccgttaccac
cacaacgaactcaccttcggccaactctacgcctatacggaaaatttcgtactgccgttc
tcccatgacgaagtggtacatggaaaacgctcgttactcgccaaaatgccgggcgatggc
tggcagaaatttgccaacctgcgcctgctgttcacttaccagatgacttaccccggaaaa
aaactcaacttcatgggcaacgaactggcccagggccgggaatggcgcatcggcggagaa
cttgactgggaactactggagcgcgagcagcaccagggaatgaaaagcctgtcgcgcgac
ctcaatcgtctctaccgtgaccggcccgccctgcacgaacttgatttcacatcgaacggc
tttgcctggatcgattgccacgacgccgaccagtcggtgctttcttacctgcggcgcgac
cgcaatggctcgttcgtggcagtgatgctgaacttcacaccagtgccgcgtctcggctat
cgcatcggagtgccccggcccggcttgtaccgcgaaatcctcaacagcgactccctgttt
tacggcggttccaaccagggcaatggcgaaggcgccgttgccgagaatacaccctggatg
ggccatccttattccatcgtgataaccgtaccgccgctggcgggaataatattggctttg
gccgaataa

DBGET integrated database retrieval system