KEGG   Sulfuricella denitrificans: SCD_n02426Help
Entry
SCD_n02426        CDS       T02857                                 

Definition
glycogen branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
sdr  Sulfuricella denitrificans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:sdr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SCD_n02426
Enzymes [BR:sdr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     SCD_n02426
Exosome [BR:sdr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SCD_n02426
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2467966..2469924
Genome map
AA seq 652 aa AA seqDB search
MEEIATRNKNSQHVSSSSLTEHDVFLFKEGTHARLSEKLGAHLITRDGQNGTHFAVWAPN
AVTVSVFGDFNGWDKVSHPLAARTDGSGIWESFVPGMVSGDCYKYHITSRDHNYQVDKAD
PYAMFSEVPPLTGSRVWDMTYTWNDEEWMSRRRAANALDAPMSIYEVHLGSWRRVPEEDN
RSLSYREIAPLLVDHMRETGFTHVELLPVTEHPFFGSWGYQTTGYFSPTSRQGTPQDLMF
LIDHLHQAGIGVILDWVPSHFPSDEHGLSYFDGTHLFEHADPRQGFHPEWKSAIFNYGRN
EVSAFLMSSALFWLDKYHIDGIRVDGVASMLYLDYGRNEGEWIPNAHGGRENLAAMQFLR
GLNEAVYRDHPDTLTIAEESTAWPMVSRPTYMGGLGFGMKWNMGWMHDTLKYYQQDPVFR
KYHHEKLTFSIWYAFTENFVLPMSHDEVVYGKGSMIGKMPGDEWQQFANLRLLYGHMWGH
PGKKLLFMGGEFGQKREWQHEESLEWHVLQYPLHSGLQRWMGDLNRCYRSEPALYEKDFS
GDGFSWVDFHDWEESVISFLRHGRNPEDSVLVVCNFTPVARQNYIVGVPRGGYWQEILNS
DAEIYGGSGVGNLGGVEASPVAAQGHYHSLSLALPPLGVVYLKQATGNRGAA
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaattgctacccggaataaaaacagccagcacgtcagttccagctcgctcacc
gagcacgacgtattccttttcaaggaaggaactcatgcccgtctttccgaaaaactggga
gcccatctcattactagagatggacaaaatggcacgcacttcgcggtgtgggcgccaaat
gccgtgactgtatcggtctttggcgatttcaatggctgggacaaggtttcccatcctctg
gccgcgcgaacggatggttccggcatatgggaaagctttgtgccgggcatggtcagcgga
gattgctacaaatatcacatcacttcgcgtgatcataactatcaggtcgacaaggccgac
ccttacgctatgttcagtgaagttccgccactcaccggttctcgtgtctgggatatgact
tatacctggaatgacgaggaatggatgtcgcggcgacgggcggccaacgcgctcgatgcg
ccaatgtcgatctacgaagtgcatctgggatcgtggcgacgggtgcccgaggaggataat
cgctccctcagctaccgggaaatcgcgccgttactggtggatcatatgcgcgaaacgggc
tttactcacgtcgaactgctgccggtcaccgagcatccgttttttggctcctggggttac
cagaccaccggctatttttccccgacctcgcgccagggcacgccacaggacttgatgttc
ctgatcgaccacctgcaccaggcgggtatcggcgtgatactcgactgggtgccctcgcac
tttcccagcgacgagcatggcctctcctatttcgacggcacccacctgttcgagcatgcc
gatccgcgtcagggcttccatcccgaatggaaaagcgccatcttcaactatggccgcaac
gaagtaagcgccttcctgatgtccagcgccctgttctggctcgacaagtaccatatcgat
ggtatccgcgtcgacggcgtcgcctcgatgctttacctcgattacggacgcaatgagggt
gagtggatccccaatgcccatggcgggcgcgaaaacctcgcggccatgcaattcctccgc
ggcctcaacgaggcggtgtatcgcgatcacccggacaccctcaccatcgccgaggaatcc
accgcctggccgatggtatcgcgcccaacctacatgggcggcctgggcttcggcatgaag
tggaacatgggctggatgcacgacacgctgaagtactaccagcaggacccggtgttccgc
aagtatcaccacgaaaagctcaccttcagcatctggtatgccttcaccgaaaatttcgtc
ctgccgatgtcgcacgacgaggtcgtgtacggcaagggatcgatgatcggcaagatgccg
ggcgacgaatggcagcaattcgccaacctgcgcctgctctacggccacatgtggggccat
cccggcaagaagttgctgttcatgggcggggagttcggccagaaacgagaatggcaacac
gaagaaagcctggaatggcatgtcctgcaatacccgctgcattccggcctgcaacgctgg
atgggcgacctcaaccgctgctacagatccgagccagcgctctacgagaaagacttttcg
ggtgatggtttcagctgggtggacttccacgactgggaagaaagcgtgatcagtttcctg
cgccatggccgcaatcccgaagacagcgtgctggtggtctgtaatttcacgccggtggcg
cgacaaaactacatcgtcggcgtgccgcgcggcggctactggcaggaaatcctcaacagc
gacgctgaaatctacggtggcagtggcgtcggcaatctgggcggcgttgaggcctcgccg
gtggcggcgcaaggccactatcactccctctcgctggccctgccgccgctgggcgtggtg
tatctgaaacaggcaaccggaaatagaggagcagcatga

DBGET integrated database retrieval system