KEGG   Sulfuricella denitrificans: SCD_n02428Help
Entry
SCD_n02428        CDS       T02857                                 

Definition
trehalose synthase
Orthology
K05343  
maltose alpha-D-glucosyltransferase/ alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
sdr  Sulfuricella denitrificans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sdr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SCD_n02428
Enzymes [BR:sdr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     SCD_n02428
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     SCD_n02428
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2471922..2475263
Genome map
AA seq 1113 aa AA seqDB search
MSKTNNKNHDTPPPVALNWGNDPLWYKDAVIYELHIKAYADGNGDGIGDFKGLTERLDHV
QSLGVNTIWLLPFYPSPQRDDGYDVSDYENVHPSYGTLDDFRAFVIEAHQRNLRVITELV
VNHTSDQHPWFQAARKAPKDSPERNFYVWSDDPNKYAGTRIIFTDSEKSNWTWDEVAQQY
FWHRFFSHQPDLNFDNPEVLQAVMNTMEFWLEMGVDGFRLDAIPYLIERDGTSNENLRET
HDVIREIRRRLEAKYPGRLLLAEANMWPEDVHEYFGDGDECQMAYHFPLMPRLYMAIAQE
DRHPVVEILAQTPDIPPNCQWAVFLRNHDELTLEMVTNKERDYMYSMYAAESRARINIGI
RRRLAPLLENNPDRIKLMNGLLLSMLGTPVLYYGDEIGMGDNIFLGDRDGVRTPMQWSSD
RNGGFSRADPQRLYLPPIQDPIYGFEAVNVESQSREPSSLLSWTRHLLAVRNTTQAFGRG
SVTMMHPGNRKILAYLREYEGEVILCVSNVSRVAQSVELDLSAYEGRVPVEMMGRSAFPP
IGKDPYFLTLMAYGFFWFRLSTDAEPPGWHLDRTPVEDLAVLVLFDGWNSFFRNRVVPWR
IAMAEKTKTQFERDILPRFLLRQRWYAAKTEPLEKATIAEHVMLQAGDTQWLLALIDIHG
AAKPARYFVPLALVFEESDEQSQRVLASVAIAKVRQQANTGLLTDAMADEQFCRTMVASI
GVSRELKAEGGTLRFLPSDAFAKIVGDTLQGATPLQRLTASSNSISLLCDRLFLKAYRHL
HAGISPELEMGRFLTDVVGFEHCVPVAGSIEFHATNGAIYTMALLQAQVTNQGDAWSHTV
GQLARLLESYGNIDEEIHDEIGPMVERMQVLARRIAELHIALARRTGDPAFDPEPVQSVD
LKNWIATVEDECRSTLELLSQRHGAWEKPLAELAEQVAEAAPALIARINRDLLSTPAGVK
TRLHGDLHLGQVLICLDDFLLIDFEGEPQRTLEERRAKHSALRDVAGMLRSFDYARHAAL
QQSATVGSDPDRLARVARLWEQSMRKGFLQIYGQVAVEGELYASVTEFEAAAKLLDLFEL
EKALYELRYEMDNRPDWIGVPLAGIAGLAGVSE
NT seq 3342 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagaccaataacaagaatcacgacacaccccccccagtcgcattaaattggggg
aacgacccgctctggtacaaggatgcggtcatctatgaactgcacatcaaagcctatgcg
gatggcaacggtgatggcataggcgatttcaagggcctgaccgagcggctcgaccacgtc
cagtcgctcggcgtcaatacgatctggctgttgccgttttacccttcgccgcaacgcgac
gacggctatgacgtatccgattatgaaaacgtacacccctcttacggcacgctggatgac
ttccgtgcgtttgtcattgaggcgcaccagcgcaatctgcgcgtcatcaccgaactggtg
gtcaaccacacctccgaccagcatccctggtttcaagctgcgcgcaaggcacccaaagat
tcgcccgagcgcaacttctacgtgtggagcgacgatccgaataaatatgcaggcacgcgt
atcatttttaccgactcagagaagtccaactggacttgggacgaggtcgcacaacagtat
ttctggcaccgctttttcagccaccagcccgacctgaattttgacaatccggaggtgctt
caggcggtaatgaacaccatggagttctggctggaaatgggcgtggatggctttcgtctc
gacgcgatcccctacctgatcgagcgcgatggcaccagtaacgaaaatctgcgcgagacc
cacgatgtcatcagggagatccgccgccgcctggaagcgaaatatccaggtcgtctgttg
ctggccgaggccaacatgtggcccgaagacgtgcacgagtatttcggcgacggtgacgaa
tgccagatggcctaccactttcccctgatgccgcgcctgtatatggccatcgcccaggaa
gatcgccatccggtggtggagatcctcgcccagacaccggacattccaccgaactgccag
tgggcggtattcctgcgcaaccacgacgaattgaccctggaaatggtgaccaacaaggaa
cgcgactacatgtacagcatgtatgccgcggaatcacgcgcacggatcaatatcggcatt
cgccgtcgtctcgctccgttgctcgaaaacaatcctgatcgcatcaagctgatgaacggc
ctgctgctgtccatgctgggcaccccggtgctgtattacggcgacgagatcggcatggga
gacaacatttttctgggtgaccgggatggcgtgcgcaccccgatgcagtggagcagtgat
cgcaatggcggcttctcgcgcgccgacccgcaacgcctgtacctgcctccgatacaggat
ccgatctatggctttgaggccgtcaatgtcgaatcgcagtcgcgcgaaccctcatcattg
ctgtcctggactcgtcacttgctggcggttcgtaacaccacccaagccttcgggcgcggc
agcgtgaccatgatgcatccgggcaatcgcaagattctggcgtatttgcgtgagtacgag
ggagaagtcatcctttgcgtcagcaacgtcagtcgcgtcgcccaatcggtggagctggat
ctcagcgcttacgagggacgcgttccggtagaaatgatgggacgaagcgcattccctccc
atcggcaaagatccctattttctgaccctgatggcctacggctttttctggttccggcta
tcgaccgatgccgaaccgcctggctggcatctcgaccgcacacccgtagaagacctggcg
gtgctggtgctgttcgatggatggaacagtttctttcgtaaccgtgtcgtgccttggcgc
atcgccatggccgaaaagacgaaaacccagttcgagcgtgacatattgccgcgcttcctg
ctgcgtcaacgttggtacgcggccaaaaccgagcctctggaaaaggccaccatcgctgaa
cacgtcatgctccaggcgggagatacacaatggctgctggcattgattgacatccacggg
gctgccaaacctgcgcgctatttcgtgccactggccctggtgtttgaggaatctgacgaa
caatctcagcgtgtcctggcatcggtagccatcgccaaggtgcgtcagcaggccaatacc
ggcttgctgaccgatgcaatggccgacgaacaattctgccgcaccatggtcgcgtctatc
ggcgtgagccgcgagctgaaggctgagggcggcacactgagattcttgcccagtgacgct
ttcgccaagatcgtcggtgacacgctacagggcgctacaccactgcagcgcctgaccgcg
agcagcaactctatcagcctgctctgtgaccggttgtttctcaaagcttaccggcacctg
catgccggcatcagcccggaactggagatggggcgattcctgactgatgtcgtcggcttc
gagcactgcgtgccggtcgctgggagcattgaattccacgctactaacggtgcgatttat
accatggcgctactgcaggcccaggtaacgaatcagggcgatgcgtggagtcatacggtc
ggccaactggcccgtctgctggaatcgtacggaaatattgacgaggaaatacacgacgaa
atcggtccgatggtcgaacgcatgcaggttctggcgcgccgcatcgctgaactgcacatc
gcactggctcgccgcactggagacccggcattcgatcccgaaccggtccagtccgttgat
ctcaagaactggatcgccactgtggaggatgagtgccgcagcacgcttgaactgttgtct
caacgtcacggggcctgggaaaaacccctggccgaattggcggagcaggtagctgaggcg
gcccccgcactcatagcgcgcatcaaccgggacttgctctcgacccccgccggagtgaag
acgcgcctgcatggcgatctgcatctcggtcaggtgctgatctgcctcgatgattttctg
ctcatcgatttcgagggcgagccgcagcgcacgcttgaagagcgtcgtgccaagcacagt
gcattgcgtgacgtcgcaggcatgctgcgttcgttcgactacgcgcgtcatgccgctttg
cagcaaagcgccacagtcggatccgatcctgaccgcctggcacgcgttgcgcgactctgg
gagcaaagcatgcgcaaaggcttcctccagatctacgggcaagtcgcggtggagggcgaa
ctgtacgccagtgtcacggaatttgaggcggcggcaaagcttcttgatctgtttgagctg
gagaaggcattgtacgaactacgttacgaaatggataaccgacctgactggatcggcgtt
ccattagcgggaattgccggactggccggtgtttcagaataa

DBGET integrated database retrieval system