KEGG   Sulfuricella denitrificans: SCD_n02430Help
Entry
SCD_n02430        CDS       T02857                                 

Definition
trehalose synthase
Orthology
K05343  
maltose alpha-D-glucosyltransferase/ alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
sdr  Sulfuricella denitrificans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sdr00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2476013..2479378
Genome map
AA seq 1121 aa AA seqDB search
MNKTNNNNHAAISANDPEWENDPLWYKDAIIYELHVKAFCDSNGDGIGDFQGLTEKLDYL
QDLGINTLWLLPFYPSPFKDDGYDISDYRNVHPDYGTRADVRNFIREAHRRGLKIITELV
INHTSDQHPWFQAARRAPAGSKKRDFYVWSDTDKKFPETRIIFTDSEKSNWAWDEVAGAY
YWHRFFSHQPDLNHNNPEVVKAVIRIMRFWLDLGVDGLRLDAIPYLCVREGTSNENLPET
HAVIKQMRAVIDAHYQNRMLLAEANQWPEDVREYFGNGDECHMTYNFPVMPRIFMAVAQE
DRHPVVEIMHQTPDIPANCQWAIFLRNHDELTLEMVTKRERDYMYQMYAADPRMRVNVGI
RRRLAPLMENNTDKIELVNFLLMTLPGSPILYYGDEIGMGDNIYLGDRNGVRTPMQWSPD
RNAGFSKADPQRLYLPPNMDPIYGYEAINVEAQARNPSSLLHWIKRLIAVRKNYKAFGRG
SITFLEPGNRKILAYVREWENETLLCVVNLSRTAQPVELDLSAFKGRVPVELLGRTAFPP
IGDLPYLLTLKGYGTYGFRLATDAEVPYWHEERLARPELPVLVLTEGWLTFSKSQAGTVR
GAIAAATQEQLQHKVLAPYIANKRWFAAKGRRIDRIEILEQGEWNTAQGSWLLTIIEVYC
AGLPPQHYFLPLAICWEEEAGEEKLQTLAPWTLAKVRQKEHIGVLYGAFGDDRFCRELVK
GIGQNIDLPLGKGQVEFRAGSAFGELADGIEAPVRQPALEQSNTAVYFGNKLFLKCYRRL
QLGTNPEVEVGRFLTEKSPFPHIVPVGGAVEFRRADGQTMTLALLQAYVENQGMGWNFAV
DYLERFLAGQLAEPAPHSTESTESPHGYCLALMDVLGRRTAELHRAFCHSTGDPDFEPEP
ITPKDLAAWSTRAHAEAVATFDGLENRRDGLSGELHSACDRLLSLRLALLDRISPQALAG
ISAAKMRYHGDYHLGQVLLVENDFIITDFEGEPARTLDERRQKHSPLRDVAGMLRSFSYV
SAMATNRATTERPADRHRLGPLVQAWEKEASEAFLKGYRDAIQGCPSWPAAPGAAERLIE
FFVIEKALYELRYEMDNRPDWLPIPLFSLLRTLVHKEGEIS
NT seq 3366 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagaccaacaataataatcacgctgccatttccgcgaacgatccagagtgggaa
aacgatcccctctggtacaaggacgccatcatttacgagctgcacgtgaaggcgttttgc
gacagcaatggcgacggcatcggcgatttccaggggttgaccgaaaaactcgactacctc
caggatctcggcatcaacaccttatggctgctgccgttctatccttcgccattcaaggac
gacggctacgatatctccgactatcgcaacgtccatccggactacggcacccgtgccgac
gttcgcaacttcatccgcgaagctcaccggcgcggcctgaaaatcatcaccgaactggtc
atcaaccacacctccgaccagcatccctggttccaggcagcgcgccgcgcgccggccggg
tcaaagaaacgcgacttctacgtctggtcggacaccgacaagaagtttcccgagacgcgc
atcatcttcaccgactcagaaaaatccaactgggcctgggacgaagtggccggcgcctac
tactggcatcgtttcttctcgcaccagcccgatctgaaccacaataacccggaggtggtg
aaggcggtgatccgcatcatgcgcttctggctcgaccttggcgtcgacggcctgcgcctg
gacgccattccctacctgtgcgtacgcgagggcaccagcaacgagaacctgcccgaaacc
cacgccgtaatcaaacagatgcgcgcggtcatcgacgcccactaccagaaccgcatgctg
ctggccgaggccaaccagtggcccgaggacgtgcgcgagtacttcggcaacggcgacgaa
tgccacatgacctacaatttcccggtcatgccgcgcattttcatggccgtagcccaggaa
gaccgccatcccgttgtcgagatcatgcatcagacgccggacatccccgccaactgccag
tgggccatcttcctgcgcaaccacgatgagttgaccctggagatggtcaccaagcgcgag
cgcgactacatgtaccagatgtacgccgctgacccgcgcatgcgcgtcaacgtcggcatt
cgccgccgcctggcgccgctgatggaaaacaacaccgacaagatcgagctagtgaatttt
ctcctcatgaccctgcctggctcgcccatcctttattacggcgacgagatcggcatgggc
gacaacatctatcttggcgaccgcaatggcgtgcgcacgcccatgcagtggagcccggac
cgcaacgccggcttttccaaggccgacccccagcggctctacctgccacccaacatggac
ccgatctacggttacgaggccatcaacgtcgaagcccaggcgcgcaatccttcctctctg
ctgcactggatcaagcgccttatcgccgtgcgcaagaactacaaagccttcggccgcggc
agcatcaccttcctggaacccggcaaccgcaagatcctcgcctatgtgcgcgagtgggag
aacgagaccctgctgtgcgtggtgaatctctcgcgcaccgcccagccagtggaactggat
ctctccgccttcaagggccgggtgccggtggaattgctcgggcgcaccgcctttccgccc
atcggcgacctgccctatctgctgaccctcaagggttacggcacctacgggttccgcctc
gctaccgacgccgaggtcccctactggcacgaggagcgcctggcacgtcccgagttgccg
gtgctggtgctcaccgagggctggctcactttctcgaaaagccaggccggcaccgttcgc
ggcgccatcgcggccgcaacccaggaacaacttcagcacaaggtactggctccctacatc
gccaacaagcgctggttcgctgccaagggccgccgcatcgaccgcatcgagatcctggag
cagggtgagtggaacaccgctcagggcagctggctgctcaccatcatcgaggtgtattgc
gccggcctgccaccccagcactatttcctgcccctggctatctgctgggaggaagaggct
ggcgaagaaaaactccagacgctggcaccatggacgctggcaaaggtgcggcaaaaggaa
cacatcggcgtgctctacggcgccttcggcgacgaccggttctgtcgcgaactggttaaa
ggcataggtcaaaatatcgatctcccgctaggcaagggacaagtcgaatttcgcgccggc
agcgcgtttggcgaactggctgacgggatcgaggcgccggtgcgccagccggcgctggaa
cagagcaacacggcggtctatttcggcaacaagctcttcctcaaatgttaccgtcgcctg
caactcggcaccaacccggaggtggaagtcggtcgcttccttaccgagaaatcgcccttc
ccgcacatcgtgcccgttggtggtgcggtggaattccgccgcgccgatggccagacgatg
acgctggcgctgctccaggcctatgttgagaaccagggcatgggctggaacttcgcggtg
gattacctggaacgatttctggccgggcagttggccgagccagcaccccattcgactgaa
tccacagagagcccccacggctactgcctcgccctgatggacgtgctcggccgccgcacc
gccgaactgcaccgggctttctgccattccaccggcgaccccgatttcgaacccgaaccg
atcacgccgaaagatctcgccgcctggtcgacccgggcacacgcagaagctgtcgccacg
ttcgacggactggagaatcgccgcgacggcctgtcgggcgaattgcactcggcctgcgac
cgcctgctgtcgctgaggctcgcgctgctcgatcgaatttccccgcaggccctcgcgggc
atttccgccgccaagatgcgctaccatggcgactatcacctcgggcaggtactgctggtg
gaaaacgacttcatcattaccgacttcgagggagaaccggcccggactctggatgagcgg
cgccagaagcattcaccgctgcgcgatgtcgccggcatgctgcgctccttcagctacgtc
tcggcgatggcgaccaatcgcgccaccactgagcgccccgccgaccggcaccgtctcggc
cccctggtgcaagcctgggagaaagaggcgagcgaggccttcctcaagggctaccgcgat
gccattcagggctgcccgtcctggccggcagcccccggcgcggcggagcggctgatcgag
tttttcgtcatcgaaaaagccctctacgagttgcgctacgaaatggacaaccggcccgac
tggctgcccatcccgcttttcagcctgcttagaacactagtccacaaagaaggagaaata
tcatga

DBGET integrated database retrieval system