KEGG   Streptococcus dysgalactiae subsp. equisimilis GGS_124: SDEG_0062Help
Entry
SDEG_0062         CDS       T00932                                 

Gene name
adhA
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sds  Streptococcus dysgalactiae subsp. equisimilis GGS_124
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sds00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SDEG_0062 (adhA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SDEG_0062 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    SDEG_0062 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SDEG_0062 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SDEG_0062 (adhA)
   00626 Naphthalene degradation
    SDEG_0062 (adhA)
Enzymes [BR:sds01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SDEG_0062 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:58119..59135
Genome map
AA seq 338 aa AA seqDB search
MKAVVVNEASTGVEVVDHEMPSIGHGEALVKVEYCGVCHTDLHVAHGDFGQVPGRILGHE
GIGIVEEIGEGVTSLQVGDRVSIAWFFEGCGHCEYCTTGRETLCRSVKNAGYSVDGGMSE
YAVVTADYAVKVPEGLDPAQASSITCAGVTTYKAIKEAGAAPGQWIVIFGAGGLGNLAVQ
YAKKVFNAHVVAVDINNDKLELAKEVGADIVVNGKEIEDVPGYIQEKTGGAHGVVVTAVS
KVAFNQAIDSVRAGGTVVAVGLPSEYMELSIVKTVLDGIKVVGSLVGTRKDLEEAFAFGA
EGLVVPVVEKVPVDTAPDVFDEMERGLIQGRKVLDFTR
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgtagttgttaatgaagctagtacaggtgttgaagttgttgatcatgaaatg
ccatcaattgggcacggagaagcacttgttaaagtcgaatactgtggtgtttgccataca
gatttgcacgtagcgcatggcgattttgggcaagttcctgggcgtattctaggccatgaa
ggcattggtatcgtcgaagaaattggtgaaggtgtaacctcattacaagttggtgatcgt
gtctctattgcttggttctttgagggttgtggccattgtgaatattgtacgactggtcgt
gaaactctctgccgttctgttaaaaatgcaggttacagcgttgatggaggaatgagcgaa
tatgctgtcgtaacagctgattacgctgtaaaagtccctgaaggacttgatcctgcccaa
gcttcatcaatcacatgtgcgggtgtcactacttataaagctatcaaagaagcgggtgct
gctccaggtcaatggattgttatttttggtgctgggggtcttggaaacctagctgttcaa
tacgctaagaaagtctttaatgctcatgttgtcgcagtcgatatcaacaatgataaacta
gagttggctaaagaagtcggcgctgatattgtggttaatggtaaagaaattgaagatgtt
ccaggttatattcaggaaaaaacaggtggagcccatggtgtcgttgtaacagctgtttcc
aaagttgcctttaaccaagcgattgatagcgtccgtgcaggaggaactgttgtagctgta
ggccttccatcagaatacatggaactgtctatcgtaaaaactgttttagatggtatcaaa
gtggtcggatcacttgtagggacacgtaaagacttggaagaagcctttgcctttggtgca
gaaggtctggttgttccggttgtcgaaaaagttccagttgatactgctccagatgtcttt
gatgaaatggaacgtggcttgattcaaggacgcaaagttttggattttactcgctaa

DBGET integrated database retrieval system