KEGG   Streptococcus dysgalactiae subsp. equisimilis GGS_124: SDEG_0199Help
Entry
SDEG_0199         CDS       T00932                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sds  Streptococcus dysgalactiae subsp. equisimilis GGS_124
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sds00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SDEG_0199
   01230 Biosynthesis of amino acids
    SDEG_0199
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SDEG_0199
  Energy metabolism
   00680 Methane metabolism
    SDEG_0199
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SDEG_0199
Enzymes [BR:sds01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SDEG_0199
Exosome [BR:sds04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SDEG_0199
  Exosomal proteins of melanoma cells
   SDEG_0199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:176218..176778
Genome map
AA seq 186 aa AA seqDB search
MKTTFYFIRHAEPNYNNHDDVLRELTEKGIVSSKKLVNQFSSITIDKFYSSPYKRSIDTI
KPLADSKNKQITTIEGLRERKLSEGWIDNFNEVARKQWEDFNYKLPNGESLKEVQERNIL
AVNTILETSRNETVVIGTHGTALSTIINYYQEDFKYEMFNKYKHEFPWIVKFEFNESRKK
NIEIII
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccacattttattttatacgtcatgctgaacctaactacaataatcatgatgac
gttttaagagagttaactgaaaaagggatagtttcaagcaaaaaattagtaaatcagttc
tcatcaataactatagacaagttttattccagtccctacaaacgttcaatagacactatc
aaaccattagcagatagtaagaataaacaaatcacaacaattgagggattaagagagcga
aaactttctgaaggatggattgataattttaatgaagtggcacgaaaacaatgggaagac
tttaattataagttgccaaatggtgaaagtctaaaagaagttcaagaaagaaatattctt
gctgtaaataccattttagaaacttctagaaatgaaacagttgtaatagggacacatgga
acagccttatcaacaataattaattattatcaagaagactttaagtatgaaatgtttaat
aaatataaacatgagtttccatggattgtcaaatttgagttcaatgagagtcgaaagaaa
aatatagaaatcatcatataa

DBGET integrated database retrieval system