KEGG   Streptococcus dysgalactiae subsp. equisimilis GGS_124: SDEG_0199Help
Entry
SDEG_0199         CDS       T00932                                 

Definition
(GenBank) phosphoglycerate mutase family protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sds  Streptococcus dysgalactiae subsp. equisimilis GGS_124
Pathway
sds00010  Glycolysis / Gluconeogenesis
sds00260  Glycine, serine and threonine metabolism
sds00680  Methane metabolism
sds01100  Metabolic pathways
sds01110  Biosynthesis of secondary metabolites
sds01120  Microbial metabolism in diverse environments
sds01130  Biosynthesis of antibiotics
sds01200  Carbon metabolism
sds01230  Biosynthesis of amino acids
Module
sds_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sds_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sds00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SDEG_0199
  Energy metabolism
   00680 Methane metabolism
    SDEG_0199
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SDEG_0199
Enzymes [BR:sds01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SDEG_0199
Membrane trafficking [BR:sds04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SDEG_0199
Exosome [BR:sds04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SDEG_0199
  Exosomal proteins of melanoma cells
   SDEG_0199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: BAH80717
UniProt: C5WEA2
Position
1:176218..176778
Genome map
AA seq 186 aa AA seqDB search
MKTTFYFIRHAEPNYNNHDDVLRELTEKGIVSSKKLVNQFSSITIDKFYSSPYKRSIDTI
KPLADSKNKQITTIEGLRERKLSEGWIDNFNEVARKQWEDFNYKLPNGESLKEVQERNIL
AVNTILETSRNETVVIGTHGTALSTIINYYQEDFKYEMFNKYKHEFPWIVKFEFNESRKK
NIEIII
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccacattttattttatacgtcatgctgaacctaactacaataatcatgatgac
gttttaagagagttaactgaaaaagggatagtttcaagcaaaaaattagtaaatcagttc
tcatcaataactatagacaagttttattccagtccctacaaacgttcaatagacactatc
aaaccattagcagatagtaagaataaacaaatcacaacaattgagggattaagagagcga
aaactttctgaaggatggattgataattttaatgaagtggcacgaaaacaatgggaagac
tttaattataagttgccaaatggtgaaagtctaaaagaagttcaagaaagaaatattctt
gctgtaaataccattttagaaacttctagaaatgaaacagttgtaatagggacacatgga
acagccttatcaacaataattaattattatcaagaagactttaagtatgaaatgtttaat
aaatataaacatgagtttccatggattgtcaaatttgagttcaatgagagtcgaaagaaa
aatatagaaatcatcatataa

DBGET integrated database retrieval system