KEGG   Streptococcus dysgalactiae subsp. equisimilis GGS_124: SDEG_0309Help
Entry
SDEG_0309         CDS       T00932                                 

Definition
(GenBank) hypothetical protein
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sds  Streptococcus dysgalactiae subsp. equisimilis GGS_124
Pathway
sds00010  Glycolysis / Gluconeogenesis
sds00051  Fructose and mannose metabolism
sds00562  Inositol phosphate metabolism
sds01100  Metabolic pathways
sds01110  Biosynthesis of secondary metabolites
sds01120  Microbial metabolism in diverse environments
sds01130  Biosynthesis of antibiotics
sds01200  Carbon metabolism
sds01230  Biosynthesis of amino acids
Module
sds_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sds_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sds00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SDEG_0309
   00051 Fructose and mannose metabolism
    SDEG_0309
   00562 Inositol phosphate metabolism
    SDEG_0309
Enzymes [BR:sds01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SDEG_0309
Exosome [BR:sds04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SDEG_0309
  Exosomal proteins of bladder cancer cells
   SDEG_0309
  Exosomal proteins of melanoma cells
   SDEG_0309
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM PEP_hydrolase ThiG
Motif
Other DBs
NCBI-ProteinID: BAH80824
UniProt: C5WEK9
Position
1:279960..280637
Genome map
AA seq 225 aa AA seqDB search
MKANLNRHFFIFNPKSYLYGEQLYQLAELADSLVTDDISIFMTAPYAELAELSKRTKHII
VTAQHMDRISPSRGMGKVLPESLVVNGVRAVFLNHAENPMTLTELVQALERAKALELITI
VCADSVAEARAIAVLNPNIILCEPTALIGTGQTSDLSYIQETNAAVKAINPDILMMQAAG
VSQADDVYQVIKAGADGTGCTSGIVKATSPKQMFQDMIAALQKAL
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcaaatcttaatcgtcatttctttatttttaatcccaagtcctacctatatggg
gaacagctctaccaattagcagagttggccgatagcttagtcactgatgatatcagtatc
tttatgacagcgccttacgccgaattagcagagcttagcaaacgcactaagcatatcatt
gtaactgctcaacacatggatcgcatatcgcctagccgtggtatggggaaggttttgcca
gaatctttagtggtaaatggtgtcagagcagtttttttaaaccatgccgaaaatccgatg
accttgacagagttagttcaagcccttgaaagggctaaggctttggaattaataacgatt
gtttgtgcagattctgttgcagaagccagagccattgccgttttaaaccccaatattatt
ttatgcgaacccaccgcgcttattggcactggccaaactagcgatttatcctatattcaa
gagaccaatgctgccgtcaaagctatcaatccagatattttgatgatgcaggctgcagga
gtaagtcaagccgatgatgtttaccaagtgatcaaggcaggtgcagatggcacaggctgt
actagtggtatcgtgaaagcaacatcacccaaacaaatgtttcaagacatgatagcagcc
ttacaaaaggctctctaa

DBGET integrated database retrieval system