KEGG   Streptococcus dysgalactiae subsp. equisimilis GGS_124: SDEG_0309Help
Entry
SDEG_0309         CDS       T00932                                 

Definition
hypothetical protein
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sds  Streptococcus dysgalactiae subsp. equisimilis GGS_124
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:sds01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:sds01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sds00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:sds00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:sds00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:279960..280637
Genome map
AA seq 225 aa AA seqDB search
MKANLNRHFFIFNPKSYLYGEQLYQLAELADSLVTDDISIFMTAPYAELAELSKRTKHII
VTAQHMDRISPSRGMGKVLPESLVVNGVRAVFLNHAENPMTLTELVQALERAKALELITI
VCADSVAEARAIAVLNPNIILCEPTALIGTGQTSDLSYIQETNAAVKAINPDILMMQAAG
VSQADDVYQVIKAGADGTGCTSGIVKATSPKQMFQDMIAALQKAL
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcaaatcttaatcgtcatttctttatttttaatcccaagtcctacctatatggg
gaacagctctaccaattagcagagttggccgatagcttagtcactgatgatatcagtatc
tttatgacagcgccttacgccgaattagcagagcttagcaaacgcactaagcatatcatt
gtaactgctcaacacatggatcgcatatcgcctagccgtggtatggggaaggttttgcca
gaatctttagtggtaaatggtgtcagagcagtttttttaaaccatgccgaaaatccgatg
accttgacagagttagttcaagcccttgaaagggctaaggctttggaattaataacgatt
gtttgtgcagattctgttgcagaagccagagccattgccgttttaaaccccaatattatt
ttatgcgaacccaccgcgcttattggcactggccaaactagcgatttatcctatattcaa
gagaccaatgctgccgtcaaagctatcaatccagatattttgatgatgcaggctgcagga
gtaagtcaagccgatgatgtttaccaagtgatcaaggcaggtgcagatggcacaggctgt
actagtggtatcgtgaaagcaacatcacccaaacaaatgtttcaagacatgatagcagcc
ttacaaaaggctctctaa

DBGET integrated database retrieval system