KEGG   Streptococcus dysgalactiae subsp. equisimilis GGS_124: SDEG_0384Help
Entry
SDEG_0384         CDS       T00932                                 

Gene name
dapE
Definition
acetylornithine deacetylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
sds  Streptococcus dysgalactiae subsp. equisimilis GGS_124
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sds01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:sds00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:358432..359805
Genome map
AA seq 457 aa AA seqDB search
MEMSTIEEQLKDCWEHPITKDYLVVLRQLIAHRSIFAQQLGLEETAQFLKEIFSAAGAQV
IVDQSYAAPFVLATFKSPRPDAKTVIFYQHYDTVPADSDQKWSSDPFTLTEREGHLYARG
VDDDKGHIIARLTALVKYLSQAQTLPVTIVFMMEGAEESASVDLEKYLKKYARNLQEADL
LIWEQGIRNEQDQLELTGGNKGILTFDMTVESAKLDIHSKYGGVIDSATWYLLEAIASLR
DRNGRLLVPAIYEQVQEPTKRELDLIEIYAIELLDDLKKLYGLELPMLQSERRDFLKTYY
YQPSIGIQGIQSGYQGQGVKTIIPSQASAKMEVRLVPGLDPKIVFEQIQTHLLDKGFDKV
NVTYTLGEKSYRSDLSAPAIQQVIDVAKPLYPKGLSLLPTSAGTGPMHTVFEALGVPIVA
FGLGHTNSRDHAGDENIAIADYCRHIVLIEELLKSYE
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggagatgtccacaatagaggaacagttaaaagattgttgggagcaccctataaccaaa
gattatctagtcgtgctgcgtcagttaattgctcaccgctctatttttgcacaacaacta
gggcttgaagaaactgctcagtttttaaaagagatttttagtgctgcaggagctcaagtt
attgtggatcagtcctatgcggctccttttgtattagctacctttaagagccctcggcca
gatgccaagacagtcattttttatcagcactatgacacggtacctgctgattctgaccaa
aaatggtctagtgatccctttaccttaacagaacgagaaggtcatttgtatgcaagaggc
gtagatgatgataaggggcatattattgctaggttaacagctcttgtgaaatacctttct
caagcacagactctgcctgttaccattgtgtttatgatggaaggcgcagaagaatctgcc
tcagtagacttagaaaaatatctgaaaaagtatgcaaggaacttgcaggaagcagacctc
ttgatttgggaacaaggtattcgcaatgaacaagaccaattggaattaactggcggcaat
aaagggattttaacctttgatatgactgttgagagtgctaagcttgatatccattctaaa
tacggtggggtaattgattcagcaacctggtatttgctagaagctatcgcttctttgcga
gataggaatggccgtcttttagtgccagccatttatgagcaggtgcaagaaccaactaag
cgagaactagatttgattgagatctatgctatcgaactgttggatgatttaaaaaagctt
tacggactagagcttcctatgttacaatcagaacggcgtgattttttgaaaacctattat
taccaaccgtccataggtattcaaggaatacagtcgggttatcagggacagggcgtcaaa
accattattccttcacaggcttccgctaagatggaggttcgtctagtgcctggacttgat
cccaaaatcgtgttcgagcagattcaaactcatttgttggacaaaggttttgataaggtc
aatgtgacctatacgttgggagaaaaaagttatcgtagtgatttgtctgcgccagctatt
caacaagtgatagatgtggcgaagcccctttaccccaaaggattatcccttttaccaacg
tcagctggaacagggcctatgcacactgtctttgaagcacttggggttccaattgtagca
tttggtttgggtcatactaatagtcgggatcatgcaggcgatgaaaatattgctatcgca
gattactgtcgccatatcgtactaatagaggagttattaaaatcttatgaatga

DBGET integrated database retrieval system