KEGG   Streptococcus dysgalactiae subsp. equisimilis GGS_124: SDEG_0384Help
Entry
SDEG_0384         CDS       T00932                                 

Gene name
dapE
Definition
acetylornithine deacetylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
sds  Streptococcus dysgalactiae subsp. equisimilis GGS_124
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sds00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SDEG_0384 (dapE)
  Amino acid metabolism
   00300 Lysine biosynthesis
    SDEG_0384 (dapE)
Enzymes [BR:sds01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     SDEG_0384 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:358432..359805
Genome map
AA seq 457 aa AA seqDB search
MEMSTIEEQLKDCWEHPITKDYLVVLRQLIAHRSIFAQQLGLEETAQFLKEIFSAAGAQV
IVDQSYAAPFVLATFKSPRPDAKTVIFYQHYDTVPADSDQKWSSDPFTLTEREGHLYARG
VDDDKGHIIARLTALVKYLSQAQTLPVTIVFMMEGAEESASVDLEKYLKKYARNLQEADL
LIWEQGIRNEQDQLELTGGNKGILTFDMTVESAKLDIHSKYGGVIDSATWYLLEAIASLR
DRNGRLLVPAIYEQVQEPTKRELDLIEIYAIELLDDLKKLYGLELPMLQSERRDFLKTYY
YQPSIGIQGIQSGYQGQGVKTIIPSQASAKMEVRLVPGLDPKIVFEQIQTHLLDKGFDKV
NVTYTLGEKSYRSDLSAPAIQQVIDVAKPLYPKGLSLLPTSAGTGPMHTVFEALGVPIVA
FGLGHTNSRDHAGDENIAIADYCRHIVLIEELLKSYE
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggagatgtccacaatagaggaacagttaaaagattgttgggagcaccctataaccaaa
gattatctagtcgtgctgcgtcagttaattgctcaccgctctatttttgcacaacaacta
gggcttgaagaaactgctcagtttttaaaagagatttttagtgctgcaggagctcaagtt
attgtggatcagtcctatgcggctccttttgtattagctacctttaagagccctcggcca
gatgccaagacagtcattttttatcagcactatgacacggtacctgctgattctgaccaa
aaatggtctagtgatccctttaccttaacagaacgagaaggtcatttgtatgcaagaggc
gtagatgatgataaggggcatattattgctaggttaacagctcttgtgaaatacctttct
caagcacagactctgcctgttaccattgtgtttatgatggaaggcgcagaagaatctgcc
tcagtagacttagaaaaatatctgaaaaagtatgcaaggaacttgcaggaagcagacctc
ttgatttgggaacaaggtattcgcaatgaacaagaccaattggaattaactggcggcaat
aaagggattttaacctttgatatgactgttgagagtgctaagcttgatatccattctaaa
tacggtggggtaattgattcagcaacctggtatttgctagaagctatcgcttctttgcga
gataggaatggccgtcttttagtgccagccatttatgagcaggtgcaagaaccaactaag
cgagaactagatttgattgagatctatgctatcgaactgttggatgatttaaaaaagctt
tacggactagagcttcctatgttacaatcagaacggcgtgattttttgaaaacctattat
taccaaccgtccataggtattcaaggaatacagtcgggttatcagggacagggcgtcaaa
accattattccttcacaggcttccgctaagatggaggttcgtctagtgcctggacttgat
cccaaaatcgtgttcgagcagattcaaactcatttgttggacaaaggttttgataaggtc
aatgtgacctatacgttgggagaaaaaagttatcgtagtgatttgtctgcgccagctatt
caacaagtgatagatgtggcgaagcccctttaccccaaaggattatcccttttaccaacg
tcagctggaacagggcctatgcacactgtctttgaagcacttggggttccaattgtagca
tttggtttgggtcatactaatagtcgggatcatgcaggcgatgaaaatattgctatcgca
gattactgtcgccatatcgtactaatagaggagttattaaaatcttatgaatga

DBGET integrated database retrieval system