KEGG   Streptococcus dysgalactiae subsp. equisimilis GGS_124: SDEG_0530Help
Entry
SDEG_0530         CDS       T00932                                 

Gene name
fpg
Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
sds  Streptococcus dysgalactiae subsp. equisimilis GGS_124
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:sds00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    SDEG_0530 (fpg)
Enzymes [BR:sds01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     SDEG_0530 (fpg)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     SDEG_0530 (fpg)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:499980..500807
Genome map
AA seq 275 aa AA seqDB search
MPELPEVETVRRGLESLVLGQEIVAVKVEVPKMVKSDLRIFLQTLPGQTIQTIGRRGKYL
VFDFGQTVLVSHLRMEGKYLLFPDEVPEQKHFHVFFTLKNGSTLVYQDVRKFGTFDLIPK
SQLSDFFAQRKLGPEPKKETFKLKPFEVALQSSKKLIKPYLLDQTLVAGLGNIYVDEVLW
AAKVHPERLSFSLKKAEIKRLHDETIRILQLGIEKGGSTVRTYRNALGADGTMQHYLQVY
GQAGKPCPRCGQAISKLKVGGRGTHICPKCQKKRS
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgccagaattaccagaagttgaaacggttcgacgaggactcgagtctttagtgctaggt
caggaaattgttgctgtcaaggtagaagtgcctaagatggtcaagtcggatttgaggatt
tttcttcagacattacctggccaaaccattcaaaccattggtcggcggggtaaatattta
gtgtttgatttcggtcagacggtccttgtgtcacatctacgcatggaaggtaagtatttg
ctttttccagatgaggtgcctgaacagaaacattttcatgttttctttaccttaaaaaat
ggatcgaccttagtgtatcaagacgtgcgtaaatttgggacctttgatcttattcctaaa
tcccaattgtcagatttttttgcccaacgaaaacttggtccagaaccaaagaaagagacc
tttaaacttaaaccgtttgaagttgctctgcaatcttccaaaaaactaatcaagccctat
cttttggatcagacgcttgttgctggtttaggaaatatttatgttgatgaagtactctgg
gcagctaaagttcaccctgagcgtctctcttttagtttaaaaaaggcggagataaaacgg
ctacatgatgaaaccattcgtatcttgcagctagggattgaaaaaggtggttcaactgtt
cggacctatcgaaatgctttaggagcggatgggacgatgcagcattatttgcaggtgtat
ggccaagcaggaaaaccttgcccacgttgtggtcaggctattagtaaactaaaagttgga
ggaagggggacacacatttgtccgaaatgtcagaaaaaaaggtcctaa

DBGET integrated database retrieval system