KEGG   Streptococcus dysgalactiae subsp. equisimilis GGS_124: SDEG_0584Help
Entry
SDEG_0584         CDS       T00932                                 

Gene name
bglA
Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
sds  Streptococcus dysgalactiae subsp. equisimilis GGS_124
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:sds00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SDEG_0584 (bglA)
Enzymes [BR:sds01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     SDEG_0584 (bglA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:555897..557321
Genome map
AA seq 474 aa AA seqDB search
MGIFPKDFLWGGAVAANQVEGAFEADAKGLSVQDVLPNGGLGEWTDSPTSDNLTLEAIDF
YHRYKEDIALFAEMGFKVFRTSIAWSRIFPNGDDDQPNEAGLQFYDDLFDELLNYGIEPL
VTLSHYETPLHLAKAYNGWTDRRLIGFFERFAQTVMERYKDKVKYWLTFNEVNSILHMPF
TSGGIMTEKEKLSLQDLYQAIHHELVASASVTKLAHEINPDVKVGCMILAMPAYPMTSDP
RDVLAAREFENLNLLFSDIHVRGKYPSYINSYFKENGIEIVFEDGDKELLAEHTVDFLSF
SYYMSVTQARNPEAYTSGQGNILGGLANPHLESSEWGWQIDPIGLRLVLNQYYDRYQIPL
FIVENGLGAKDQLVQTAGGSMTVHDDYRIDYMSHHLVQVAKAIEDGVEVMGYTAWGCIDC
VSMSTAQLSKRYGLIYVDRNDDGTGQLTRYKKKSFDWYRQVIQTNGRYLEDNFS
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgggaatttttccaaaagatttcttatggggcggcgcagtagctgccaaccaagtggaa
ggagcatttgaggcagacgcaaaaggtttgtccgtacaagacgtccttccaaacggtggg
ctaggagaatggacagatagtcctaccagcgataatttaactttagaggcgattgatttt
taccaccgctataaagaagacattgctctttttgccgagatgggctttaaagtctttcga
acgtctattgcttggtctcgtatttttccaaatggtgacgatgaccagcccaatgaagca
ggtttgcaattttatgatgacttattcgatgaattgttgaactatggcatcgaaccctta
gtgaccttgtcgcattatgagacacctctgcatttggccaaagcctataatggttggaca
gatagacgtctgattggcttttttgagcgctttgctcagacagtcatggaacgctataag
gacaaagtcaaatactggttgacctttaacgaagtcaactcgattttacacatgcccttt
accagtggtggcatcatgacagaaaaagaaaagctgagcctgcaagatttataccaagct
attcatcatgaattggtagcatctgctagtgtcacaaagctagcgcatgaaatcaatcct
gatgttaaagttgggtgtatgattttggcgatgcctgcttatccaatgacctctgatccg
agagatgtgcttgctgcgcgtgaatttgaaaaccttaatctcttattttcagatattcat
gtgagaggcaagtatccttcatatattaattcttattttaaagaaaatgggattgagatt
gtttttgaagacggagacaaggaattattagcggaacatacggttgattttctgtctttt
agctattacatgagtgtcacacaagcccgcaatccagaagcttacacatctggtcaagga
aatattctaggcggtctggccaatccgcatttagaatcttcagaatggggctggcagata
gacccgattggtctgcgattggtcttgaatcagtattatgatcgctaccaaattcctttg
tttattgttgaaaatggcttaggggcaaaggatcagctggtgcaaaccgcaggtggcagc
atgacggttcacgatgattatcgcattgactacatgagtcatcatctcgtacaagttgcc
aaagcgattgaagatggcgttgaggtcatgggttacactgcttggggctgtattgattgt
gtctctatgtcaacagcccaattaagcaagcgttatggcctgatttacgttgaccgaaat
gatgatggtactggtcaactcacacgctataagaaaaaatcgtttgattggtaccgacaa
gtcattcaaaccaatggacgttaccttgaagataatttttcctaa

DBGET integrated database retrieval system