KEGG   Streptococcus dysgalactiae subsp. equisimilis GGS_124: SDEG_0619Help
Entry
SDEG_0619         CDS       T00932                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
sds  Streptococcus dysgalactiae subsp. equisimilis GGS_124
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:sds00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    SDEG_0619
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SDEG_0619
Enzymes [BR:sds01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     SDEG_0619
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(586275..586799)
Genome map
AA seq 174 aa AA seqDB search
MIPLTKLSVTPRICHMPNLYDFTVKAQDGSDISLVNYKEKVVLVVNTATKCGLTPQYQAL
QALYDTYHDKGFEVLDFPCNQFLNQAPGDAEEINHFCSLTYHTTFPRFAKIKVNGKDADP
LFTWLKEEKSGPLGKRIEWNFAKFLIDQNGQVIKRYSSKTDPKLIEEDLKALLG
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
gtgataccgttgaccaaattatcagttacaccgaggatatgtcacatgcctaatctctat
gattttacggttaaggctcaggacggcagtgacatctcactagttaactacaaagaaaaa
gtggttttggtcgtgaatacagctaccaaatgtgggctaaccccacaataccaggccttg
caagcactatatgacacataccatgacaagggatttgaggtcttagattttccttgcaac
caatttttaaatcaagctccaggagatgctgaggagattaatcacttttgcagtctgacc
tatcacactactttccctcgctttgcaaaaatcaaagtgaatggtaaagacgctgatcct
ttgttcacctggttaaaagaagaaaaaagtgggcccctcgggaaacgcatcgaatggaac
ttcgctaaatttctcattgaccaaaatggtcaagtcattaaacgctattcctcaaagaca
gatcctaaactaattgaagaagaccttaaagcacttcttggttaa

DBGET integrated database retrieval system