KEGG   Streptococcus dysgalactiae subsp. equisimilis GGS_124: SDEG_0629Help
Entry
SDEG_0629         CDS       T00932                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sds  Streptococcus dysgalactiae subsp. equisimilis GGS_124
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sds00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SDEG_0629 (tpiA)
   01230 Biosynthesis of amino acids
    SDEG_0629 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SDEG_0629 (tpiA)
   00051 Fructose and mannose metabolism
    SDEG_0629 (tpiA)
   00562 Inositol phosphate metabolism
    SDEG_0629 (tpiA)
Enzymes [BR:sds01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SDEG_0629 (tpiA)
Exosome [BR:sds04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SDEG_0629 (tpiA)
  Exosomal proteins of bladder cancer cells
   SDEG_0629 (tpiA)
  Exosomal proteins of melanoma cells
   SDEG_0629 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:598465..599223
Genome map
AA seq 252 aa AA seqDB search
MSRKPIIAGNWKMNKTPQEAKAFVEAVASKLPSNDLVDVAVAAPAVDLVTTIEAAKDSVL
KVAAQNCYFENAGAFTGETSPKVLAEMGADYVVIGHSERRDYFHETDEDINKKAKTIFAN
GLTPILCCGESLETYEAGKAVEFVGAQVSAALAGLSEEQVASLVLAYEPIWAIGTGKSAT
QDDAQKMCKAVRDVIAADFGQEVADKVRVQYGGSVKPENVKDYMACPDVDGALVGGASLE
ADSFLALLDFLN
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccaattattgccggtaactggaaaatgaacaaaacccctcaagaagca
aaagcattcgttgaggctgtagcaagcaaattaccttcaaacgatcttgtagatgttgcg
gtagcagcgccagctgttgatttggtaacaactatcgaagctgctaaagattcagttctt
aaagttgctgcgcaaaactgctattttgaaaatgcaggagcctttactggtgaaacatca
ccaaaagtgcttgctgaaatgggagctgactacgttgttattggtcactcagaacgccgt
gattacttccatgaaacagatgaagacattaacaaaaaagcaaaaactatttttgcgaat
gggttaactccaatcctatgttgtggggaatctcttgaaacttacgaagcaggtaaagct
gttgagtttgttggtgctcaggtttctgcggctcttgcaggtctttctgaagagcaagtg
gcttcacttgttttagcttacgagccaatctgggcaatcggtactggtaaatcagctact
caagatgatgctcaaaaaatgtgtaaagctgtacgtgacgtgattgcagcagactttggg
caagaagttgctgataaagttcgcgttcaatacggtggttctgtaaaacctgaaaacgtt
aaagattacatggcttgtccagatgttgatggtgcccttgttggtggtgcatcattagaa
gctgatagcttcctcgctttgcttgattttcttaactaa

DBGET integrated database retrieval system