KEGG   Streptococcus dysgalactiae subsp. equisimilis GGS_124: SDEG_0660Help
Entry
SDEG_0660         CDS       T00932                                 

Definition
fructose-1,6-bisphosphatase (EC:3.1.3.11)
Orthology
K04041  
fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
sds  Streptococcus dysgalactiae subsp. equisimilis GGS_124
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sds00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SDEG_0660
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SDEG_0660
   00030 Pentose phosphate pathway
    SDEG_0660
   00051 Fructose and mannose metabolism
    SDEG_0660
  Energy metabolism
   00680 Methane metabolism
    SDEG_0660
Enzymes [BR:sds01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     SDEG_0660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:628659..630572
Genome map
AA seq 637 aa AA seqDB search
MSKYYRLLKEKFPTKSSLATEMINLEAICHLPKGTEHFLSDLHGEYEAFDYLLRNGSGSI
KKKLQECFPDKDPGTIDLLCQYIYYPAEKINANTLLSEQALQEELTSFLPDLLQLVKYIG
GKYTRSKVRKLLPKDYAYIMEELLTEGQPDKNKENYYSAIIGKVIELKQLENLFIAFATL
IQQLAIDHLHVVGDIFDRGKYPDLILDRLMTFQHIDIQWGNHDITWMGAVSGSMICMVNV
IRIAARYNSIELIEDRYGINLRRLIDYSQTYFTPKVVFQPILDGDVISEQDERVLNCLQQ
ATALLQFKLEHQLIHRRPEFEMMASSALDRIRPESEEMLVGEKTYPLTDFPFDMVDWQTP
GSLTTEEEDLLDDLLERFQQSDRLRHHIEFLFSKGAIYHISNNHLLYHGCIPMHSNGDFK
SICLQGHFLSGKTLMDFYEEKVRQAYQHPDIQDDFATDLFWYLWCGEGSSLFGKQRMTTF
ERYYIEDKETHKEKKNPYYHLREKEDICQRLLAEFTLDETGHIVNGHTPVQEKSGEIPIK
AGGKMIIIDGGLAKGYQKKTGIAGYTLISNSYGLELVAHNPFSSVEAVLNGECDIIFIKR
LVEEVAERTLVKQTDNGKELLKEIEDLHYLYHHFDEY
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaagtactatcgtctcttgaaagaaaaattcccaacaaagtcttctctggctacc
gaaatgattaacctagaagccatttgccatttgcccaaaggaaccgagcattttctgagt
gatcttcatggagaatatgaggcctttgattacctcttgcgaaatggttctggatccatc
aaaaagaaattacaggaatgttttcccgacaaagaccctgggaccattgacctgctttgt
cagtacatttactaccctgctgaaaaaatcaatgctaataccttgttgtcggaacaagca
ttgcaagaagaattaaccagctttctacccgacttattacagttggttaagtacatcgga
ggcaagtatactcgctctaaagtgagaaaattgttacccaaagattatgcctatatcatg
gaagaattgttgacggaaggccaacctgataaaaataaagaaaattattattcagcaatt
attggtaaagtgattgaactcaagcagttggaaaatctctttattgcttttgcgaccttg
attcagcaattagccattgatcatttgcatgtggtgggagatatttttgaccgcgggaaa
tacccagacttgattttggatcggctcatgacttttcagcatattgatattcagtggggc
aaccacgacatcacctggatgggggcagtttctgggtcgatgatttgcatggtcaatgtg
attcggattgcagcgaggtacaacagcattgagctcattgaagaccgctacggaattaac
cttcgtcgcttgattgattatagccaaacctactttacccctaaggtcgtttttcagcct
attttggatggggatgtgatttcagaacaagatgagcgggtgttgaattgtttgcagcag
gctacagctttactacaattcaagttggaacatcaattgattcaccgtcggcctgaattt
gagatgatggcatcgagcgccttagaccgcattcgaccagaaagtgaggaaatgctggtg
ggtgagaaaacctacccactaactgattttccttttgacatggtggactggcaaactcct
ggaagcctaaccacagaagaagaggacttattggatgatttgcttgagcgtttccaacaa
tcagaccgcctgcgtcatcacatagaattcctcttttcgaaaggtgctatctatcatatt
tccaataatcacttgctttatcacggttgtatccccatgcattccaacggtgattttaaa
tccatttgcttacagggacactttttatctggcaaaaccctgatggatttttacgaagaa
aaagtgaggcaggcctaccaacaccctgatattcaggacgattttgcgaccgatttgttt
tggtatttgtggtgtggagaagggtcttctctatttggcaagcagcgcatgaccactttc
gaacgttattatatcgaggataaggaaacccataaagaaaagaaaaatccttattatcac
ttaagggaaaaagaagacatctgccaacgtcttttggctgaatttaccttggatgagaca
gggcatattgtcaatgggcacacgcctgtccaggaaaagagtggtgagattccgattaaa
gctggtgggaaaatgattattattgatggtggattggcgaaaggttatcagaaaaaaaca
ggtatcgcaggctataccttaatttccaacagttacggcttagagttggtggctcataac
cccttttcatcagtggaagctgttttaaatggagaatgtgacattatttttatcaaacga
ttggtcgaagaagtggccgaacgtaccttggtcaaacagacagataatggcaaggagctc
ctcaaagaaattgaagacctgcattacctctaccaccattttgatgagtattaa

DBGET integrated database retrieval system