KEGG   Streptococcus dysgalactiae subsp. equisimilis GGS_124: SDEG_0660Help
Entry
SDEG_0660         CDS       T00932                                 

Definition
fructose-1,6-bisphosphatase (EC:3.1.3.11)
Orthology
K04041  
fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
sds  Streptococcus dysgalactiae subsp. equisimilis GGS_124
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:sds01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sds00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:sds00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:sds00051]
Metabolism; Energy metabolism; Methane metabolism [PATH:sds00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:628659..630572
Genome map
AA seq 637 aa AA seqDB search
MSKYYRLLKEKFPTKSSLATEMINLEAICHLPKGTEHFLSDLHGEYEAFDYLLRNGSGSI
KKKLQECFPDKDPGTIDLLCQYIYYPAEKINANTLLSEQALQEELTSFLPDLLQLVKYIG
GKYTRSKVRKLLPKDYAYIMEELLTEGQPDKNKENYYSAIIGKVIELKQLENLFIAFATL
IQQLAIDHLHVVGDIFDRGKYPDLILDRLMTFQHIDIQWGNHDITWMGAVSGSMICMVNV
IRIAARYNSIELIEDRYGINLRRLIDYSQTYFTPKVVFQPILDGDVISEQDERVLNCLQQ
ATALLQFKLEHQLIHRRPEFEMMASSALDRIRPESEEMLVGEKTYPLTDFPFDMVDWQTP
GSLTTEEEDLLDDLLERFQQSDRLRHHIEFLFSKGAIYHISNNHLLYHGCIPMHSNGDFK
SICLQGHFLSGKTLMDFYEEKVRQAYQHPDIQDDFATDLFWYLWCGEGSSLFGKQRMTTF
ERYYIEDKETHKEKKNPYYHLREKEDICQRLLAEFTLDETGHIVNGHTPVQEKSGEIPIK
AGGKMIIIDGGLAKGYQKKTGIAGYTLISNSYGLELVAHNPFSSVEAVLNGECDIIFIKR
LVEEVAERTLVKQTDNGKELLKEIEDLHYLYHHFDEY
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaagtactatcgtctcttgaaagaaaaattcccaacaaagtcttctctggctacc
gaaatgattaacctagaagccatttgccatttgcccaaaggaaccgagcattttctgagt
gatcttcatggagaatatgaggcctttgattacctcttgcgaaatggttctggatccatc
aaaaagaaattacaggaatgttttcccgacaaagaccctgggaccattgacctgctttgt
cagtacatttactaccctgctgaaaaaatcaatgctaataccttgttgtcggaacaagca
ttgcaagaagaattaaccagctttctacccgacttattacagttggttaagtacatcgga
ggcaagtatactcgctctaaagtgagaaaattgttacccaaagattatgcctatatcatg
gaagaattgttgacggaaggccaacctgataaaaataaagaaaattattattcagcaatt
attggtaaagtgattgaactcaagcagttggaaaatctctttattgcttttgcgaccttg
attcagcaattagccattgatcatttgcatgtggtgggagatatttttgaccgcgggaaa
tacccagacttgattttggatcggctcatgacttttcagcatattgatattcagtggggc
aaccacgacatcacctggatgggggcagtttctgggtcgatgatttgcatggtcaatgtg
attcggattgcagcgaggtacaacagcattgagctcattgaagaccgctacggaattaac
cttcgtcgcttgattgattatagccaaacctactttacccctaaggtcgtttttcagcct
attttggatggggatgtgatttcagaacaagatgagcgggtgttgaattgtttgcagcag
gctacagctttactacaattcaagttggaacatcaattgattcaccgtcggcctgaattt
gagatgatggcatcgagcgccttagaccgcattcgaccagaaagtgaggaaatgctggtg
ggtgagaaaacctacccactaactgattttccttttgacatggtggactggcaaactcct
ggaagcctaaccacagaagaagaggacttattggatgatttgcttgagcgtttccaacaa
tcagaccgcctgcgtcatcacatagaattcctcttttcgaaaggtgctatctatcatatt
tccaataatcacttgctttatcacggttgtatccccatgcattccaacggtgattttaaa
tccatttgcttacagggacactttttatctggcaaaaccctgatggatttttacgaagaa
aaagtgaggcaggcctaccaacaccctgatattcaggacgattttgcgaccgatttgttt
tggtatttgtggtgtggagaagggtcttctctatttggcaagcagcgcatgaccactttc
gaacgttattatatcgaggataaggaaacccataaagaaaagaaaaatccttattatcac
ttaagggaaaaagaagacatctgccaacgtcttttggctgaatttaccttggatgagaca
gggcatattgtcaatgggcacacgcctgtccaggaaaagagtggtgagattccgattaaa
gctggtgggaaaatgattattattgatggtggattggcgaaaggttatcagaaaaaaaca
ggtatcgcaggctataccttaatttccaacagttacggcttagagttggtggctcataac
cccttttcatcagtggaagctgttttaaatggagaatgtgacattatttttatcaaacga
ttggtcgaagaagtggccgaacgtaccttggtcaaacagacagataatggcaaggagctc
ctcaaagaaattgaagacctgcattacctctaccaccattttgatgagtattaa

DBGET integrated database retrieval system