KEGG   Streptococcus dysgalactiae subsp. equisimilis GGS_124: SDEG_0660Help
Entry
SDEG_0660         CDS       T00932                                 

Definition
(GenBank) putative fructose-1,6-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
sds  Streptococcus dysgalactiae subsp. equisimilis GGS_124
Pathway
sds00010  Glycolysis / Gluconeogenesis
sds00030  Pentose phosphate pathway
sds00051  Fructose and mannose metabolism
sds00680  Methane metabolism
sds01100  Metabolic pathways
sds01110  Biosynthesis of secondary metabolites
sds01120  Microbial metabolism in diverse environments
sds01130  Biosynthesis of antibiotics
sds01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sds00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SDEG_0660
   00030 Pentose phosphate pathway
    SDEG_0660
   00051 Fructose and mannose metabolism
    SDEG_0660
  Energy metabolism
   00680 Methane metabolism
    SDEG_0660
Enzymes [BR:sds01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     SDEG_0660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2 Metallophos
Motif
Other DBs
NCBI-ProteinID: BAH81162
UniProt: C5WFJ7
Position
1:628659..630572
Genome map
AA seq 637 aa AA seqDB search
MSKYYRLLKEKFPTKSSLATEMINLEAICHLPKGTEHFLSDLHGEYEAFDYLLRNGSGSI
KKKLQECFPDKDPGTIDLLCQYIYYPAEKINANTLLSEQALQEELTSFLPDLLQLVKYIG
GKYTRSKVRKLLPKDYAYIMEELLTEGQPDKNKENYYSAIIGKVIELKQLENLFIAFATL
IQQLAIDHLHVVGDIFDRGKYPDLILDRLMTFQHIDIQWGNHDITWMGAVSGSMICMVNV
IRIAARYNSIELIEDRYGINLRRLIDYSQTYFTPKVVFQPILDGDVISEQDERVLNCLQQ
ATALLQFKLEHQLIHRRPEFEMMASSALDRIRPESEEMLVGEKTYPLTDFPFDMVDWQTP
GSLTTEEEDLLDDLLERFQQSDRLRHHIEFLFSKGAIYHISNNHLLYHGCIPMHSNGDFK
SICLQGHFLSGKTLMDFYEEKVRQAYQHPDIQDDFATDLFWYLWCGEGSSLFGKQRMTTF
ERYYIEDKETHKEKKNPYYHLREKEDICQRLLAEFTLDETGHIVNGHTPVQEKSGEIPIK
AGGKMIIIDGGLAKGYQKKTGIAGYTLISNSYGLELVAHNPFSSVEAVLNGECDIIFIKR
LVEEVAERTLVKQTDNGKELLKEIEDLHYLYHHFDEY
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaagtactatcgtctcttgaaagaaaaattcccaacaaagtcttctctggctacc
gaaatgattaacctagaagccatttgccatttgcccaaaggaaccgagcattttctgagt
gatcttcatggagaatatgaggcctttgattacctcttgcgaaatggttctggatccatc
aaaaagaaattacaggaatgttttcccgacaaagaccctgggaccattgacctgctttgt
cagtacatttactaccctgctgaaaaaatcaatgctaataccttgttgtcggaacaagca
ttgcaagaagaattaaccagctttctacccgacttattacagttggttaagtacatcgga
ggcaagtatactcgctctaaagtgagaaaattgttacccaaagattatgcctatatcatg
gaagaattgttgacggaaggccaacctgataaaaataaagaaaattattattcagcaatt
attggtaaagtgattgaactcaagcagttggaaaatctctttattgcttttgcgaccttg
attcagcaattagccattgatcatttgcatgtggtgggagatatttttgaccgcgggaaa
tacccagacttgattttggatcggctcatgacttttcagcatattgatattcagtggggc
aaccacgacatcacctggatgggggcagtttctgggtcgatgatttgcatggtcaatgtg
attcggattgcagcgaggtacaacagcattgagctcattgaagaccgctacggaattaac
cttcgtcgcttgattgattatagccaaacctactttacccctaaggtcgtttttcagcct
attttggatggggatgtgatttcagaacaagatgagcgggtgttgaattgtttgcagcag
gctacagctttactacaattcaagttggaacatcaattgattcaccgtcggcctgaattt
gagatgatggcatcgagcgccttagaccgcattcgaccagaaagtgaggaaatgctggtg
ggtgagaaaacctacccactaactgattttccttttgacatggtggactggcaaactcct
ggaagcctaaccacagaagaagaggacttattggatgatttgcttgagcgtttccaacaa
tcagaccgcctgcgtcatcacatagaattcctcttttcgaaaggtgctatctatcatatt
tccaataatcacttgctttatcacggttgtatccccatgcattccaacggtgattttaaa
tccatttgcttacagggacactttttatctggcaaaaccctgatggatttttacgaagaa
aaagtgaggcaggcctaccaacaccctgatattcaggacgattttgcgaccgatttgttt
tggtatttgtggtgtggagaagggtcttctctatttggcaagcagcgcatgaccactttc
gaacgttattatatcgaggataaggaaacccataaagaaaagaaaaatccttattatcac
ttaagggaaaaagaagacatctgccaacgtcttttggctgaatttaccttggatgagaca
gggcatattgtcaatgggcacacgcctgtccaggaaaagagtggtgagattccgattaaa
gctggtgggaaaatgattattattgatggtggattggcgaaaggttatcagaaaaaaaca
ggtatcgcaggctataccttaatttccaacagttacggcttagagttggtggctcataac
cccttttcatcagtggaagctgttttaaatggagaatgtgacattatttttatcaaacga
ttggtcgaagaagtggccgaacgtaccttggtcaaacagacagataatggcaaggagctc
ctcaaagaaattgaagacctgcattacctctaccaccattttgatgagtattaa

DBGET integrated database retrieval system