KEGG   Streptococcus dysgalactiae subsp. equisimilis GGS_124: SDEG_0846Help
Entry
SDEG_0846         CDS       T00932                                 

Gene name
dyr
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
sds  Streptococcus dysgalactiae subsp. equisimilis GGS_124
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sds00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SDEG_0846 (dyr)
   00670 One carbon pool by folate
    SDEG_0846 (dyr)
Enzymes [BR:sds01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     SDEG_0846 (dyr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:835819..836316
Genome map
AA seq 165 aa AA seqDB search
MTKEMIAIWAEDEAGLIGVDGKLPWYLPRELQHFKETTLNQAILMGRVTFDGMNRRLLPN
RQTLVMTRDVNYQVDGVLTMTSVEEVLDWYHAQEKTLYVIGGSKVLEAFDGYFNRVIKTV
VHHQFEGDTYRPKLDLSRFREESQTFYPKDANNPYDFTVTVLKHQ
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaggaaatgattgctatctgggcagaagatgaagcaggtcttatcggggttgat
ggcaagctaccatggtacctgccaagagagctgcaacattttaaagaaacaactttgaat
caagctattttaatggggagagtaacctttgatggcatgaatcgtaggctgcttcctaat
cgtcaaacccttgtgatgacaagagatgtaaactatcaagtagatggggtattgaccatg
actagtgttgaggaagtgctggattggtatcatgcacaggaaaaaacactttacgttatt
ggtggaagcaaggttttagaagcctttgacggttattttaatcgtgtgattaaaacagtg
gttcatcaccaatttgaaggggatacctaccgaccaaaacttgacttaagtcgttttagg
gaagaaagccaaaccttctatccaaaggatgcaaacaatccttacgattttacagtgacg
gttttaaaacaccaatag

  All links  
No link information was found.   
DBGET integrated database retrieval system