KEGG   Streptococcus dysgalactiae subsp. equisimilis GGS_124: SDEG_0846Help
Entry
SDEG_0846         CDS       T00932                                 

Gene name
dyr
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
sds  Streptococcus dysgalactiae subsp. equisimilis GGS_124
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sds00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:sds00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:835819..836316
Genome map
AA seq 165 aa AA seqDB search
MTKEMIAIWAEDEAGLIGVDGKLPWYLPRELQHFKETTLNQAILMGRVTFDGMNRRLLPN
RQTLVMTRDVNYQVDGVLTMTSVEEVLDWYHAQEKTLYVIGGSKVLEAFDGYFNRVIKTV
VHHQFEGDTYRPKLDLSRFREESQTFYPKDANNPYDFTVTVLKHQ
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaggaaatgattgctatctgggcagaagatgaagcaggtcttatcggggttgat
ggcaagctaccatggtacctgccaagagagctgcaacattttaaagaaacaactttgaat
caagctattttaatggggagagtaacctttgatggcatgaatcgtaggctgcttcctaat
cgtcaaacccttgtgatgacaagagatgtaaactatcaagtagatggggtattgaccatg
actagtgttgaggaagtgctggattggtatcatgcacaggaaaaaacactttacgttatt
ggtggaagcaaggttttagaagcctttgacggttattttaatcgtgtgattaaaacagtg
gttcatcaccaatttgaaggggatacctaccgaccaaaacttgacttaagtcgttttagg
gaagaaagccaaaccttctatccaaaggatgcaaacaatccttacgattttacagtgacg
gttttaaaacaccaatag

DBGET integrated database retrieval system