KEGG   Streptococcus dysgalactiae subsp. equisimilis GGS_124: SDEG_0862Help
Entry
SDEG_0862         CDS       T00932                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
sds  Streptococcus dysgalactiae subsp. equisimilis GGS_124
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sds00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SDEG_0862 (folP)
Enzymes [BR:sds01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     SDEG_0862 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:851661..852467
Genome map
AA seq 268 aa AA seqDB search
MKIGKFVIDGNAAIMGILNVTPDSFSDGGSYTTVQKALQQVDQLIAGGAKIIDVGGESNR
PGYQFVSVAAADEIERVVPMIKAIKAKYDVLISIDTYKTETARAALEAGADILNDVWAGL
YDGEMLALAAEYDVPIILMHNQKEEVYQDVTQDVCDFLSARAQAAIDAGVPKDNIWIDPG
FGFAKSVQHNMELLKGLDRVCQLGYPVLFGISRKRVVDALLGGNTKAKERDGATAALSAY
ALGKGCQLVRVHDVKANQEIVAVLSQLM
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgaagattgggaaatttgtgattgacggcaacgctgctattatgggaattttaaatgtg
actcccgattccttttccgatggtggttcatacacgacagtacaaaaagccttacaacag
gtagatcagctaattgctggtggggccaaaattattgatgttggcggtgaatccaatcga
ccaggttaccaatttgtgagcgttgctgctgctgatgaaattgagcgtgtcgttcccatg
attaaagccattaaagcaaaatatgatgtgttaatcagtattgatacctacaaaacagaa
accgcaagagcagctttagaagctggtgctgacattttaaatgatgtctgggcaggttta
tacgatggggaaatgcttgctctagcagcagagtatgatgtgcctattatcttgatgcat
aaccaaaaagaagaagtctatcaagatgtaacacaagatgtttgtgattttttgagtgct
agagctcaggcagccatagatgctggagtaccaaaagacaatatttggattgatccagga
tttggatttgccaaatctgttcaacacaatatggagttattaaaaggattggatcgtgtt
tgtcagttgggttatcctgtcttgtttggtatttcgagaaagcgtgttgtagatgccttg
ttaggcggcaacaccaaagctaaagagcgagacggagcgacagcagccttatctgcttat
gctcttggaaaaggctgtcagctggtacgcgtacacgatgtcaaggctaatcaagaaatt
gtggctgttttgagtcagttgatgtga

DBGET integrated database retrieval system