KEGG   Streptococcus dysgalactiae subsp. equisimilis GGS_124: SDEG_0864Help
Entry
SDEG_0864         CDS       T00932                                 

Gene name
folK
Definition
hydroxymethylpterin pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
sds  Streptococcus dysgalactiae subsp. equisimilis GGS_124
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sds00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SDEG_0864 (folK)
Enzymes [BR:sds01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     SDEG_0864 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:852831..853331
Genome map
AA seq 166 aa AA seqDB search
MTIVYLSLGTNMGDREEYLSQAVQSLAKIPNTHLLAQSSIYETAAWGKTDQADFLNMACQ
LDTQLTAADFLKETQAIEQSLGRVRHEKWGPRTIDIDILLFGEEVYDTKELKVPHPYMTE
RAFVLLPLLELNADLKLPVRQVPLSVDLAALDTSDITLFSARQTES
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgaccattgtttatttaagtttagggaccaatatgggagaccgagaagagtacttgagt
caagctgttcagtcccttgctaagattcctaacacccatttactagcccaatcgtctatt
tatgaaacggctgcttggggtaagacagatcaagctgacttccttaacatggcctgtcaa
ttagatacacaattaaccgcggctgatttcttaaaagaaacacaagctattgagcaatct
cttggtcgtgtgaggcatgaaaaatggggaccaagaaccattgacattgatatcttgcta
tttggagaagaggtttatgacacaaaggaattgaaagtgccacacccatatatgactgag
cgtgcttttgttttgcttcctttattagaattaaacgctgatttgaagctgcccgtccgt
caagtccctttatcggttgatttggcggctttagacacctcagacatcacgcttttttca
gctcgacagacagagtcttag

DBGET integrated database retrieval system