KEGG   Streptococcus dysgalactiae subsp. equisimilis GGS_124: SDEG_1248Help
Entry
SDEG_1248         CDS       T00932                                 

Gene name
acoC
Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sds  Streptococcus dysgalactiae subsp. equisimilis GGS_124
Pathway
sds00010  Glycolysis / Gluconeogenesis
sds00020  Citrate cycle (TCA cycle)
sds00620  Pyruvate metabolism
sds01100  Metabolic pathways
sds01110  Biosynthesis of secondary metabolites
sds01120  Microbial metabolism in diverse environments
sds01130  Biosynthesis of antibiotics
sds01200  Carbon metabolism
Module
sds_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sds00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SDEG_1248 (acoC)
   00020 Citrate cycle (TCA cycle)
    SDEG_1248 (acoC)
   00620 Pyruvate metabolism
    SDEG_1248 (acoC)
Enzymes [BR:sds01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SDEG_1248 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 PLA2_B
Motif
Other DBs
NCBI-ProteinID: BAH81743
UniProt: C5WH78
Position
1:complement(1195829..1197238)
Genome map
AA seq 469 aa AA seqDB search
MAFEIIMPKLGVDMQEGEIIEWKKQEGDTVNEGDVLLEIMSDKTNMELEAEDSGVLLKIV
RPAGDTVPVTEVIGYIGAEGESVDTIASSEKTTEIPVPASADAGPTVAPKEDVASPAPQV
AATAIPQGNGGKVRATPAARKVAAEMGIDLGQVPGTGPKGRVHKEDVENFKGAQPKASPL
ARKIAADKGIDLATVSGTGFNGKVMKEDIMAILEAAKPAEAKAPAAKEEKVVELPEGVEH
KPMSAMRKAISKGMTNSYLTAPTFTLNYDIDMTEMIALRKKLIDPIMAKTGLKVSFTDLI
GMAVVKTLMKPEHEYMNASLINNANDIEFHRFVNLGIAVGLDDGLIVPVIHGADKMSLSD
FVLASKDVIKKAQTGKLKAAEMSGSTFSITNLGMFGTKTFNPIINQPNSAILGVGATIPT
PTVVDGEIVARPIMAMCLTIDHRLVDGMNGAKFMVDLKKLMENPFELLI
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggcatttgaaattattatgccaaagctcggcgttgacatgcaagagggcgagatcatc
gagtggaaaaaacaagaaggtgataccgtcaatgaaggtgatgtccttcttgaaatcatg
tcagacaaaaccaatatggaacttgaggcagaagactcaggtgttctattgaaaattgtt
cgtccagctggtgatactgtacctgtaactgaagttatcggttacattggtgcagaaggt
gaatcagtagatactattgcttcaagtgaaaaaacaacagaaattccagttcctgcttca
gcagatgcaggaccaacagtagctccaaaagaagatgtggccagtccagctcctcaggta
gcagcgacagctattccgcaaggaaatggtggaaaagttcgtgctactccagctgcacgt
aaggttgcagcagaaatgggcattgaccttggtcaagttccaggaacaggaccaaaaggg
cgtgtccataaagaagatgttgagaactttaaaggtgctcaaccgaaagcttcaccactt
gctcgtaaaatcgctgctgataaaggtatcgacttggcgactgtttcaggtactggcttt
aacggtaaggtcatgaaagaagacatcatggctattcttgaagctgctaaaccagctgaa
gcaaaagcaccagcagctaaagaagaaaaagttgttgagcttccagagggtgtggaacac
aagccaatgtcagctatgcgtaaggcaatctctaaaggtatgacaaactcttaccttact
gcgcctacctttacgcttaactacgatattgatatgacagaaatgatcgcccttcgtaag
aagttaattgacccaatcatggctaaaacaggccttaaagtcagcttcacagacttgatt
ggtatggcagtggttaaaacgttgatgaaacctgagcatgagtacatgaatgcttccctc
atcaataacgctaatgatattgaattccaccgctttgtgaacctgggtattgccgtaggt
cttgatgatggtcttattgttccagttatccatggtgcagataagatgagcttgtcagat
ttcgtgcttgcttcaaaagatgtgattaaaaaagcgcaaactggtaagttgaaagcagct
gaaatgtctggatcaaccttctcaatcacaaacttgggaatgtttggtacgaagacattt
aacccaattattaaccaaccaaactcagcaattcttggtgttggagcaactatcccaact
ccaacggttgtggatggtgagattgttgcccgtccaattatggcgatgtgcttaaccatc
gaccatcgcttggtagacggtatgaacggtgcaaaattcatggttgacctcaagaaattg
atggaaaatccatttgaattgttaatctga

DBGET integrated database retrieval system