KEGG   Streptococcus dysgalactiae subsp. equisimilis GGS_124: SDEG_1359Help
Entry
SDEG_1359         CDS       T00932                                 

Definition
glycosyl hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
sds  Streptococcus dysgalactiae subsp. equisimilis GGS_124
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sds00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SDEG_1359
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    SDEG_1359
Enzymes [BR:sds01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SDEG_1359
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1310620..1312416)
Genome map
AA seq 598 aa AA seqDB search
MKGKEMTHLVDLRKKPYHLDDQAIAWVEETIASMSLEEKIGQLFVNMGASRTEEYLTQVL
NDYKIAAVRYNKGMADEVWEQNYILQTKSKIPLLIAANTEAGGDGAVNDGTKVGDEIKVA
ATNDPKYAYEMGRIAGIEAAAVGCNASFAPIVDLTRNWRNPIIASRNWGSNVDQIITLSK
EYMRGIMEHGIMPFAKHFPGDGIDERDHHLSFASNPMTKDEWMSTFGRIYGELAEAGLPG
IMAGHIHLPNVEKELHPERELDDMLPASLNKTLLDELLRGELGYNGAIVTDASHMVAMTA
SMPRRLMLPTAVEAGCDLFLFFNDPDEDLQWMKEGYEAGILTEERLHDALCRTLGLKARL
GLHLYEGRREEIMLPKEEAMTLINTKEAQAIADEVADKAITLVKDKQKDIFPVTPERYKR
ILIVNVEGLKGGFGAMIAGQKKRASDVVKELLEARGHDVTVWESTEERIMQLPESERAAA
IANVYAQKQPISNLTDHYDLILNLVDVNSGGTVQRIVWPAAKGTPDQPFYVHEIPTIVVS
VQHAFALADMPQVGTYINVYDGKDNTMKALVEKLAGESNFTGVSPVDAFCGLIDTHLW
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaggaaaagaaatgacacatttagtagatttacgcaaaaaaccttatcaccttgat
gaccaagccatcgcttgggtagaagaaaccattgcctccatgtccttggaggagaaaatt
gggcagttatttgttaacatgggagctagtcgtaccgaagagtatttgacccaagtgctt
aatgattataaaattgcggcggttcgctacaataaaggcatggccgacgaagtttgggaa
caaaactacatcttacaaaccaaatcaaaaattccactcttaattgctgctaacaccgaa
gcaggtggcgatggcgcagttaatgatggcacaaaggttggggacgagattaaggttgcc
gcaacaaatgatccaaagtacgcttacgaaatggggcgcattgcagggattgaagcagca
gcggttggctgtaacgcttcctttgctcctattgttgacctgacacgcaactggcgcaac
ccaattatcgctagccgtaactggggttcaaatgtggaccaaatcattaccttgtctaaa
gagtacatgagagggattatggagcatggcattatgccatttgccaaacatttcccaggg
gacgggattgatgaacgtgaccatcacctctcttttgcatcaaacccgatgacaaaagac
gagtggatgtctaccttcggtcgtatttatggtgaactagctgaagctggtcttcctggt
attatggcaggtcatatccatttgccaaatgttgagaaagagttgcatcctgaacgtgag
ttggatgacatgctaccagcttcactcaacaaaacgttgttggatgaattgctgcgcggg
gagcttggttacaatggggctattgtgacagatgcttctcacatggttgccatgacagct
tctatgccacgtcgtttgatgctgccaacggctgtggaagcgggatgtgacctcttctta
ttctttaatgatccagatgaagacttgcaatggatgaaagaaggctatgaggctggtatt
ttgacagaagaacgactccatgatgccctttgccgtacgcttggtttgaaagcacgtcta
ggacttcatttatatgaaggtcgtcgtgaagagattatgctaccaaaagaagaagcgatg
acactgattaataccaaagaagcgcaagccattgctgacgaggtagctgacaaagccatt
actcttgttaaagataagcaaaaggatattttcccagtcacgcctgaacgctacaaacgc
attttgattgtcaatgtagaaggtctcaaaggtggttttggtgcgatgattgcagggcag
aaaaaacgagcatccgatgtggtcaaagaattgctagaagcgcgtggtcatgacgtcacg
gtgtgggagtcaacggaagaacgtatcatgcaattgccggaaagcgaacgtgccgcagcc
attgctaatgtttatgcccaaaaacaacccatttccaatttgacagaccattacgattta
atccttaaccttgttgatgtcaactctggtggaacagttcagcgtattgtctggccagca
gccaaggggacaccggatcagccattttatgtgcatgaaatcccaacaattgtggtatca
gttcaacatgcctttgccttagcagacatgccacaagtagggacttatatcaatgtttac
gacggtaaggacaataccatgaaagctttggtggagaaattggctggcgaatccaacttc
accggtgtttcaccagtagatgctttctgtggccttattgacacgcatttgtggtga

DBGET integrated database retrieval system