KEGG   Streptococcus dysgalactiae subsp. equisimilis GGS_124: SDEG_1412Help
Entry
SDEG_1412         CDS       T00932                                 

Gene name
bglA
Definition
beta-glucosidas (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
sds  Streptococcus dysgalactiae subsp. equisimilis GGS_124
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sds00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1361628..1363073)
Genome map
AA seq 481 aa AA seqDB search
MTYTFPKDFLWGGATAANQFEGAYNLGGKGLSVQDVTPQGGVPAKIGDLNPLITDEPTED
NLKLEGIDFYHRYKEDIALFAEMGFKTFRMSIAWSRIFPKGDEKEPNEAGLKFYDDVFDE
LAKYGIEPLVTLSHYETPLHLAREYNGWASRDLIGFYENYVRTVFTRYKDKVKYWLTFNE
VNSVLHAPFMSGGISTPVEELSKQDLYQAVHHELVSSASATKIAREINPDFKVGCMVIAM
PAYGMTSNPLDQLAVHQFENQNYLFSDIHARGKYPNYIKRFFKENDIEIQFAEGDEEMLK
NTVDFISFSYYMSVAQAHNPEEYSTGKGNILGGISNPYLESSEWGWQIDPVGLRLVLNDF
YDRYQLPLFIVENGLGAKDVLVDGPNGPTVEDDYRIDYLRKHLVQVGEALQDGVELLGYT
TWGPIDLVSASTAQLSKRYGFIYVDRNDDGTGSLARYKKKSFDWYKEVIATNGQALYSQM
N
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgacttatacatttccaaaagatttcctgtggggtggtgccacagctgccaaccaattt
gaaggggcttataaccttggtggtaaaggcctttctgttcaggacgtcactcctcagggt
ggtgttcctgctaaaattggagatttaaatcccttgattacagatgaaccaacggaagac
aatctcaaattggaagggattgacttttatcaccgttataaagaagacattgctcttttt
gcggagatgggctttaaaacattccgtatgtctatcgcttggtctcggatttttccaaaa
ggcgatgagaaagaacctaatgaggcagggcttaagttttacgatgatgtttttgatgaa
ttagccaagtacggcatcgagccattggtgacgctttcccattacgaaacaccgctgcac
ttggcgcgtgagtacaacggctgggctagtcgtgaccttatcggtttttacgaaaactat
gtgcgtactgtctttacacgttacaaggacaaggtcaaatattggttgacctttaatgag
gtgaactcggttcttcatgcgccgtttatgtccggaggtatctctacaccagttgaagag
ttatcaaaacaagacttgtatcaagcagtgcaccatgagttagtatcgtcagcatcagcc
actaagattgctcgtgagatcaatcctgactttaaggtcggttgtatggtcattgctatg
ccagcttatggaatgacgtcaaatcctttggatcaattggctgtgcatcaatttgaaaat
caaaactatctcttctcagacattcatgcgcgtgggaaataccctaactacatcaaacgc
ttcttcaaagaaaatgatattgagattcaattcgcagagggtgatgaggaaatgcttaaa
aacacggttgatttcatttccttctcctactatatgtctgtggcgcaagcccataatcct
gaagaatacagcactggaaaaggtaatatcttaggtggtatttccaatccttatctggaa
tcttctgagtggggctggcagattgacccagttggtcttcgtttggtcctcaatgacttt
tatgaccgctatcaattaccactctttatcgtggaaaatggtctgggggctaaagatgtg
cttgtcgatggaccgaatggaccaacagttgaagacgattatcgtatcgactatctccga
aaacacttggtacaggttggtgaagcacttcaagacggcgttgagttacttggttacacc
acttggggaccaattgatttggtatcagcctcaacggcacagttgtctaaacgttatggc
ttcatctatgttgaccgcaatgatgacggaactggaagcctggctcgttacaagaaaaaa
tcatttgattggtataaagaagtgattgccacaaatggtcaagccttgtatagtcaaatg
aattaa

DBGET integrated database retrieval system