KEGG   Streptococcus dysgalactiae subsp. equisimilis GGS_124: SDEG_1469Help
Entry
SDEG_1469         CDS       T00932                                 

Gene name
gpmA
Definition
phosphoglyceromutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sds  Streptococcus dysgalactiae subsp. equisimilis GGS_124
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sds00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SDEG_1469 (gpmA)
   01230 Biosynthesis of amino acids
    SDEG_1469 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SDEG_1469 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    SDEG_1469 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SDEG_1469 (gpmA)
Enzymes [BR:sds01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SDEG_1469 (gpmA)
Exosome [BR:sds04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SDEG_1469 (gpmA)
  Exosomal proteins of melanoma cells
   SDEG_1469 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1424338..1425033)
Genome map
AA seq 231 aa AA seqDB search
MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIEFDLAFTSVLTR
AIKTTNLALENAGQLWVPTEKSWRLNERHYGALTGKNKAEAAEQFGDEQVHIWRRSYDVL
PPAMDKNDEYSAHNDRRYADLDPALIPDAENLKVTLERAMPYWEEKIAPALLDGKNVFVG
AHGNSIRALVKHIKGLSDDEIMDVEIPNFPPLVFELDEKLNIVKEYYLGGE
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaattggttttcgctcgccacggtgagtcagaatggaacaaagctaacctcttc
actggttgggcagatgttgatctttcagaaaaagggacacaacaagcgattgatgcaggt
aaattgatcaaagaagcaggtattgaatttgaccttgctttcacttcagtattgacacgt
gctatcaaaacaactaaccttgctcttgaaaatgctggtcaattgtgggtaccaactgaa
aaatcatggcgtttgaacgagcgtcactatggtgctttaactggtaaaaacaaagcagaa
gctgctgaacaatttggtgatgagcaagttcacatttggcgtcgttcatacgatgtttta
ccaccagctatggataaaaatgacgagtattcagcacacaatgatcgtcgttatgctgat
cttgatccagctcttatcccagatgctgaaaacttaaaagtaactcttgaacgcgcaatg
ccttactgggaagaaaaaattgctccagctcttcttgacggtaaaaacgtctttgttggc
gcacacggtaactcaatccgcgctcttgttaaacacattaaaggtctttcagatgacgaa
atcatggatgtggaaattccaaacttcccaccacttgttttcgaattggatgaaaaactt
aacattgttaaagaatactacctcggtggtgaataa

DBGET integrated database retrieval system