KEGG   Streptococcus dysgalactiae subsp. equisimilis GGS_124: SDEG_1515Help
Entry
SDEG_1515         CDS       T00932                                 

Gene name
glcK
Definition
glucokinase/xylose repressor (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
sds  Streptococcus dysgalactiae subsp. equisimilis GGS_124
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sds00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SDEG_1515 (glcK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SDEG_1515 (glcK)
   00052 Galactose metabolism
    SDEG_1515 (glcK)
   00500 Starch and sucrose metabolism
    SDEG_1515 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    SDEG_1515 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SDEG_1515 (glcK)
   00524 Butirosin and neomycin biosynthesis
    SDEG_1515 (glcK)
Enzymes [BR:sds01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SDEG_1515 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1473212..1474183)
Genome map
AA seq 323 aa AA seqDB search
MSQKLLGIDLGGTTVKFGILTAAGEVQEKWAIETNILEGGKHIVPDIIASIKHRLELYGL
SSADFIGIGMGSPGAVDRIANTVTGAFNLNWKETQEVGSIIEKELGIPFAIDNDANVAAL
GERWVGAGENNPDVVFMTLGTGVGGGIIADGNLIHGVAGAGGEIGHMIVEPENGFACTCG
SHGCLETVASATGVVKVARLLAEAYEGDSTIKAAIDNGDNVTSKDIFMAAEAGDSFADSV
VEKVGYYLGLASANISNILNPDSVVIGGGVSAAGEFLRSRIEKYFVTFTFPQVRYSTKIK
IAELGNDAGIIGAASLARQFITE
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaaagttactggggattgatttaggtggaaccactgttaaatttggtatttta
acagcagcaggagaagtccaagaaaaatgggcgattgagactaatattttagaagggggc
aagcacattgtccctgatatcatcgcttccatcaaacaccgcttggaattatatggtcta
agcagtgcagattttattggtatcggtatggggtcaccaggggctgttgaccgtattgct
aatacagtgaccggagcattcaaccttaactggaaagaaactcaggaagtcggttccatt
attgaaaaagaattaggtattccttttgccattgataatgatgccaatgtggctgctctt
ggtgagcgttgggttggagctggcgaaaacaatcctgatgttgttttcatgacactagga
actggtgtcggtggggggattatcgccgatggtaacctgattcatggtgttgcaggagca
ggtggtgaaatcggccacatgattgttgaaccggaaaatggctttgcttgtacttgtggc
tcacacggctgtttggaaacagtagcctcagcaacaggtgttgtcaaggtagcacgttta
ttggcagaagcttatgaaggagattctactattaaagccgccattgataatggggacaat
gtcaccagcaaagatattttcatggccgctgaagcaggagattcctttgcagattctgtt
gtggaaaaggttggttactaccttggtcttgcgtcagcaaatatctcaaatatcttgaat
ccagattcagtggttattggtggaggcgtgtcggcagcaggagaattcttacgttcacgc
attgaaaaatattttgtgaccttcaccttcccacaagtgaggtattcaactaaaattaag
attgcagagcttggcaatgatgctggaattatcggtgcagctagccttgctcgacaattt
atcacagagtag

DBGET integrated database retrieval system