KEGG   Streptococcus dysgalactiae subsp. equisimilis GGS_124: SDEG_1577Help
Entry
SDEG_1577         CDS       T00932                                 

Gene name
lacZ
Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
sds  Streptococcus dysgalactiae subsp. equisimilis GGS_124
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sds00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:sds00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1531259..1534759)
Genome map
AA seq 1166 aa AA seqDB search
MACRQKSSETVTKITTRPLRANSNEEQETDMTPDSKEQAYQYHYIDQEGRKQPFNKGWRF
LRADVQLAQDPSFDDSNWSCINLPHDFSLAQPYTRNGEAESAYKLGGVGWYRHYLVLDEE
LAGCHVTLTFEGAYMETEVYVNGQFIGKHLNGYQEFTYDISGAVTFGAENLLAVRVDNKV
PSSRWYSGSGLYREVSLSVLPKVHFEDDQVNLSLIVPTDDINQGLAALALQFDLSQPVSP
ADYQVSLKLWEQTLGSQNRQLVYQQAEQSLQDLDGIEPYGTTITLPRVNLWSPDQPHLYD
LELTLWHQGKTCDVFYRETGFRQIVFDANQGLLVNGKATKIKGVCLHHDQGGLGACAYQD
AIARQLTLLKAMGANTIRSTHNPSSPKLRQLANRLGFFVIEEAFDTWTYAKNGNVNDLSR
YFHQAVGEENAAHLKRVHFQATSWAQYSTEAMVWSAKHDPSILMWSVGNELMEGFSADVS
HYPDVMRSICQWLAVIDTSKPITFGDNKLKESDFYWNKKVTQMAELLSQLESPQGVVGLN
YANGDDYDRLHQQHPHWIIYGSETASAINSRSYYQQTKKIVHDTYGLTSYDHATVDWGAV
ASQAWYDTITRDFVAGECVWTGFDYLGEPTPWNKIDSGAADTWPSPKNAYFGILDTAGFP
KDSYYFYQSQWANNQTTLHLLPAWREDCLYLDDQGLVEVVVYSNATSVQLLFEDEQGGLK
NYGTKAFDTMTTPMGYAYQLYQGDDASETPHENLYLTWRIPYQKGLLRAVAYDASGKQIQ
KTSGRSQVRTYGAVAQLTWQAFEAPFETTQELLYLELSLLDKSGELVSHAQELIRIEVEG
PAQLLAVDNGNPVDHTLYHLSSRQAYGGKLLVILALTGEVGQVKVSAYGPGDLRALFQKE
VSERVSQEYLLTTFLDKYPLREIPMGKTISFEQLTTDVSKMHTDNRVQEKELRFDKGHFS
VMTYWHALAWPLSFTPYKAYGDLGQDIILPEWLQATDAQGHLVKKAFPITWDFTTKTFTQ
SVVIRGQANCYGHLIPVEARLSPRQEEKRRHQDISLVAKQSLLASSRDRLIYRYQYATIQ
ALGAISLRQRTTHPLTLNISLRSASQSSVSQICLEQQQVQVTEQETVIFLEEVMDVLQLE
ITLELVAGTKGDLEQAGLQIGLWDLV
NT seq 3501 nt NT seq  +upstreamnt  +downstreamnt
atggcttgtcgccaaaagagttcagagaccgttacaaagataactaccaggccattaagg
gcgaacagtaacgaggagcaggagactgatatgacaccagatagcaaggagcaggcgtac
caataccactatattgatcaagaaggaagaaagcagccctttaacaagggctggcgcttt
ctaagggcagatgtgcaattggctcaagacccttcatttgacgattccaattggtcatgt
atcaatctgccgcatgattttagccttgctcaaccctatacgcgaaatggagaagcagaa
agtgcttataaattaggtggagtggggtggtatcggcattaccttgtgttagatgaggag
ttagcgggttgtcatgttaccctcacttttgagggggcctatatggaaacagaagtttat
gttaatggacaattcattggtaaacacttaaatggctaccaggaatttacctatgatatc
tctggtgctgtgacttttggagctgagaaccttctggctgtcagggtagacaataaggtt
cccagttcacgttggtactcgggtagcggcctttaccgagaagtgagcttgtctgtgctt
cccaaggttcactttgaggacgaccaagtcaaccttagcttaatcgtaccaactgatgat
atcaatcagggattagccgcacttgccttgcaatttgaccttagtcaaccggtttcacca
gctgactatcaggttagtctgaagttgtgggaacaaacgctcggaagtcaaaatcgtcaa
cttgtttatcaacaagctgagcagtctctgcaggacttggatgggatagaaccatatggt
acgaccatcactttgcctagagttaatctgtggtcacctgatcaacctcacttgtatgac
cttgaattgaccctttggcatcagggtaaaacgtgtgatgttttttatcgggaaaccggt
tttcgacagattgtctttgatgccaaccaggggctgctagtgaatggcaaagctacaaaa
atcaagggggtctgtcttcatcatgaccaaggtgggttaggagcctgtgcctatcaagat
gctatcgcaaggcagttaaccttactaaaagctatgggagctaataccattcgcagtact
cataatcccagcagtccaaagttacgtcaactggctaatcgactcggtttttttgtcatt
gaagaagcctttgacacctggacctatgctaaaaatggcaatgtcaatgatttatcacgt
tattttcatcaagccgtcggagaggagaatgctgcccacttaaaaagggttcattttcag
gcaaccagttgggctcagtatagtacagaggccatggtctggtctgccaaacatgacccg
tcgatcttgatgtggtctgtcggtaatgaattgatggaaggtttttcggcagatgtcagc
cactatcctgacgtgatgagatctatttgccagtggcttgctgtgattgatacctctaag
cccattacctttggggacaataagctgaaggaaagtgatttctattggaacaagaaggtg
acacaaatggcagagctgcttagtcaactagagtcgcctcaaggagtagtcggtctcaat
tatgccaatggagacgattatgaccgacttcaccaacaacacccccattggataatatat
ggttcagagacagcatctgccattaacagccgttcctattatcagcagacgaagaagatc
gttcatgatacctatggcttgacctcttacgatcacgccacagtagattggggagctgtc
gctagtcaagcttggtatgatacgattacccgtgattttgttgcaggagaatgcgtttgg
acgggttttgattatctaggtgaaccaacgccttggaataaaattgacagcggtgctgcg
gacacttggccgtctcccaagaacgcttactttggtattttagatactgcgggctttcca
aaagacagttattatttttaccagagccagtgggcaaacaatcagactaccctccacctc
ctgccagcctggcgagaagactgtctttaccttgacgatcaggggttagtagaagttgtg
gtttatagcaatgctaccagtgttcagcttctgtttgaagatgagcagggtggtttaaag
aattatgggacgaaggcatttgataccatgactactccaatgggatatgcttatcagctc
tatcaaggggatgacgcgtctgaaactcctcatgagaatctttacctgacctggcggatt
ccttatcaaaaaggtctgttaagagcagtggcctatgatgcgtctgggaaacaaattcaa
aagactagtggacgttctcaggtcagaacctatggagcagtggcacagcttacgtggcaa
gcctttgaagcaccttttgagaccacacaagaattactttatctggaattatcgctttta
gataaatcaggcgagttggtcagccatgctcaagagttgattcggattgaagtcgaagga
ccagcacagttactggcagtggataatggcaatcctgttgaccataccctgtatcatttg
tcatcccgacaagcttacggtgggaaattattggttattctcgctctaacaggagaagta
ggacaagtgaaggtaagtgcctatggtccaggagatttgcgagccttatttcaaaaagag
gtctctgagcgtgtctcacaggaatacctcttgacgacatttttagataaataccctctt
cgggaaatcccgatgggaaagacgatttcttttgagcagctcactacagacgttagtaaa
atgcatactgacaatagggttcaagagaaagagttgcggtttgataaagggcatttttca
gtcatgacctattggcatgctctggcttggcccttatctttcacaccttataaggcttat
ggtgatttagggcaagatattatcttaccagaatggcttcaggctacggatgctcaagga
catttggtgaaaaaagctttccccatcacttgggattttacgacaaaaacttttacccag
tcagtagtgataagaggacaagcaaactgttacggtcatctcatcccagtagaagcaagg
cttagcccacgtcaagaggaaaaaagacgacatcaggatattagcttggtggctaaacaa
tccttgcttgcctcgtctcgggaccgtctgatttatcggtatcagtacgctaccatccaa
gctcttggtgccattagtttacggcaaaggaccactcatcctctcactctgaacataagt
cttcgctctgctagtcaatcgtcggttagccagatttgcttggaacaacagcaggttcaa
gtgacggagcaagaaactgttattttcttagaagaggtgatggatgtcttgcaattagag
attacccttgaactggttgcaggaacaaagggtgatttggagcaagctggccttcagatt
ggtctctgggatttggtctaa

DBGET integrated database retrieval system