KEGG   Streptococcus dysgalactiae subsp. equisimilis GGS_124: SDEG_1703Help
Entry
SDEG_1703         CDS       T00932                                 

Definition
short chain dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
sds  Streptococcus dysgalactiae subsp. equisimilis GGS_124
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sds00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    SDEG_1703
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    SDEG_1703
Enzymes [BR:sds01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     SDEG_1703
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1636397..1636864
Genome map
AA seq 155 aa AA seqDB search
MTHTKEVAFITGAASGIGKQIGETFLKEGKTVVFSDINQEKLDQVVADYTKEGYDAFSVV
CDVTKEEAINAAIDTVVEKYGRIDILVNNAGLQHVAMIEDFPTEKFEFMIKIMLTAPFIA
IKRAFPTMKAQKHGRIINMASINGVIGFAGKSAYL
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgacacatactaaagaagttgcatttatcactggtgctgcaagcggaattggaaaacaa
atcggggaaaccttcttaaaagaaggtaaaacggttgttttttccgacattaatcaagaa
aaactggatcaggttgttgctgactatactaaagaaggctatgacgcttttagtgttgtg
tgcgatgtcaccaaagaagaagccatcaatgctgctattgatacggttgttgaaaaatat
ggtcgtattgatattttggttaacaacgcaggccttcaacatgttgccatgattgaagat
tttccaactgaaaaatttgaattcatgattaaaatcatgttgacagcaccatttattgcc
attaaacgtgcttttcctacaatgaaagctcaaaaacatggacgtatcattaatatggca
tccattaatggtgtcatcggctttgctggaaaatcagcttatttgtag

DBGET integrated database retrieval system