KEGG   Streptococcus dysgalactiae subsp. equisimilis GGS_124: SDEG_1703Help
Entry
SDEG_1703         CDS       T00932                                 

Definition
short chain dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
sds  Streptococcus dysgalactiae subsp. equisimilis GGS_124
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:sds00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:sds00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1636397..1636864
Genome map
AA seq 155 aa AA seqDB search
MTHTKEVAFITGAASGIGKQIGETFLKEGKTVVFSDINQEKLDQVVADYTKEGYDAFSVV
CDVTKEEAINAAIDTVVEKYGRIDILVNNAGLQHVAMIEDFPTEKFEFMIKIMLTAPFIA
IKRAFPTMKAQKHGRIINMASINGVIGFAGKSAYL
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgacacatactaaagaagttgcatttatcactggtgctgcaagcggaattggaaaacaa
atcggggaaaccttcttaaaagaaggtaaaacggttgttttttccgacattaatcaagaa
aaactggatcaggttgttgctgactatactaaagaaggctatgacgcttttagtgttgtg
tgcgatgtcaccaaagaagaagccatcaatgctgctattgatacggttgttgaaaaatat
ggtcgtattgatattttggttaacaacgcaggccttcaacatgttgccatgattgaagat
tttccaactgaaaaatttgaattcatgattaaaatcatgttgacagcaccatttattgcc
attaaacgtgcttttcctacaatgaaagctcaaaaacatggacgtatcattaatatggca
tccattaatggtgtcatcggctttgctggaaaatcagcttatttgtag

DBGET integrated database retrieval system