KEGG   Streptococcus dysgalactiae subsp. equisimilis GGS_124: SDEG_1741Help
Entry
SDEG_1741         CDS       T00932                                 

Gene name
glpO
Definition
alpha-glycerophosphate oxidase (EC:1.1.3.21)
Orthology
K00105  
alpha-glycerophosphate oxidase [EC:1.1.3.21]
Organism
sds  Streptococcus dysgalactiae subsp. equisimilis GGS_124
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:sds00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SDEG_1741 (glpO)
Enzymes [BR:sds01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.21  glycerol-3-phosphate oxidase
     SDEG_1741 (glpO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1673467..1675305)
Genome map
AA seq 612 aa AA seqDB search
MEFSKETRRLALQKMQERDLDLLIIGGGITGAGVALQAAASGLDTGLIEMQDFAEGTSSR
STKLVHGGLRYLKQFDVEVVSDTVSERAVVQQIAPHIPKPDPMLLPVYDEPGSTFSMFRL
KVAMDLYDLLAGVSNTPAANKVLTKEEVLKREPDLKQEGLLGGGVYLDFRNNDARLVIEN
IKRANRDGALIASHVKAEDFLLDDKGQIIGVKARDLLSDQEIIIKAKLVINTTGPWSDEI
RQFSHKGQPIHQMRPTKGVHLVVDRQKLPVSQPVYVDTGLNDGRMVFVLPREEKTYFGTT
DTDYTGDLEHPQVTQEDVDYLLGVVNNRFPNANVTIDDIESSWAGLRPLLSGNSASDYNG
GNSGKVSDDSFDHLVDTVKAYINHEDSREAVEKAIKQVETSTSEKELDPSAVSRGSSFER
DENGLFTLAGGKITDYRKMAEGALKVIIQVLKEDFGKSFKLINSTTYPVSGGEINPANVD
SEIEAYAQLGTLSGLSMDDARYLANLYGSNAPKVFALTRQLTAAEGLSLAETLSLHYAMD
YEMALKPTDYFLRRTNHLLFMRDSLDALIDPVINEMAKHFEWSDQERVAQEDDLRRVIAD
NDLSALKGHQEG
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atggaattttcaaaagagacaagacgtttagctctccaaaaaatgcaagaaagagattta
gacctactgattattgggggaggtattacgggtgctggtgtggcgcttcaggcggcagct
agtggcctagataccggtctgattgagatgcaagattttgcggaaggaacctccagtcgg
tcgaccaaattggttcatgggggacttcgttacttgaaacagtttgacgttgaagtcgtc
tcagatactgtttcagaacgtgctgtggtccaacagattgcacctcatattcctaagcca
gatcctatgttattacctgtttatgacgaacctggcagcacctttagcatgttccgtttg
aaggtcgctatggatttgtatgatcttttagcaggcgtgtccaatacgccagcggccaac
aaggtgttaaccaaagaagaagtcttaaaacgagaaccagacttaaaacaagaaggcctg
cttggtggtggcgtttaccttgatttccgcaataatgatgcaaggcttgttattgagaat
attaagcgtgctaatcgtgatggggctcttattgccagccacgtgaaggcagaagatttc
ttgctagatgataaagggcagattatcggtgtgaaggcgcgtgatttgctgtcagatcaa
gaaatcattatcaaggctaaattagtcatcaacaccacaggtccatggagtgatgagatt
cgtcaattctctcataagggacaaccgattcatcaaatgcgccctacaaaaggggtgcat
ctggtagtggaccgtcaaaaattaccagtgtctcaacctgtctatgttgacacagggtta
aatgatggtcgtatggtctttgtcttgccacgtgaagaaaaaacttattttggaacaacg
gacacggactacactggagacttggagcacccacaagttactcaagaagatgtggattat
ttgttaggcgttgtcaataaccgctttccaaatgccaacgtgaccattgatgatattgaa
agcagttgggctggtcttcgccccttgttatcaggtaatagtgcttctgactacaatggt
ggcaacagcggtaaagtcagtgatgatagttttgatcacttagttgatactgtcaaagcc
tatattaaccacgaagatagccgagaagctgttgaaaaagctattaagcaggttgaaacc
agcacatctgaaaaagaattggatccgtctgcagtgtcacgaggttcaagttttgagcgt
gacgagaacggcctctttaccttggcaggtggtaagattacggattaccgtaagatggcc
gaaggtgctttgaaagtcattatccaagtcttgaaagaagatttcggcaaatcgtttaag
cttatcaattcaaccacctatccagtttctggcggtgaaattaacccagccaatgtagat
tcggaaatagaagcctatgctcaattaggaactcttagtggtctttcgatggatgatgct
aggtatttggcaaacctttatggttctaatgcgccaaaagtctttgccttaactcgtcaa
ttaacagcagctgaagggttaagtttagctgaaaccttgtccttacattatgcgatggat
tatgaaatggcccttaaaccgacagattatttcttgagaagaacaaatcacctcttattt
atgcgagatagcctagatgctttgattgacccagtgattaatgaaatggctaaacatttt
gaatggtctgatcaggaaagagtggcacaagaagacgatcttcgtcgcgtgattgcagac
aatgatttgagtgccctaaaaggccatcaggagggttaa

DBGET integrated database retrieval system