KEGG   Streptococcus dysgalactiae subsp. equisimilis GGS_124: SDEG_1849Help
Entry
SDEG_1849         CDS       T00932                                 

Gene name
alaT
Definition
aminotransferase AlaT (EC:2.6.1.1)
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
sds  Streptococcus dysgalactiae subsp. equisimilis GGS_124
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sds00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    SDEG_1849 (alaT)
   01230 Biosynthesis of amino acids
    SDEG_1849 (alaT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SDEG_1849 (alaT)
   00290 Valine, leucine and isoleucine biosynthesis
    SDEG_1849 (alaT)
Enzymes [BR:sds01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     SDEG_1849 (alaT)
    2.6.1.66  valine---pyruvate transaminase
     SDEG_1849 (alaT)
Amino acid related enzymes [BR:sds01007]
 Aminotransferase (transaminase)
  Class I
   SDEG_1849 (alaT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1770013..1771227)
Genome map
AA seq 404 aa AA seqDB search
MKIIEKSSKLEHVAYDIRGPVLDEANRMIANGEKILRLNTGNPAAFGFEAPDEVIRDLIV
NARLSEGYSDSKGIFSARKAIMQYCQLKGFPEVDIEDIYLGNGVSELISMSLQALLDDGD
EVLVPMPDYPLWTACVSLGGGKAVHYLCDEEADWYPDIADIKSKITSRTKAIVVINPNNP
TGALYPKEVLEDIVALAREHQLIIFADEIYDRLVMDGEEHVAIASLAPDVFCVSMNGLSK
SHRIAGFRVGWMVLSGPKDHVKGYIEGLNMLANMRLCSNVLAQQVVQTSLGGRQSVDELL
LPGGRIFEQRNFIHEAINAIPGLSAVKPKAGLYLFPKIDRNMYRIDDDEEFVLQLLKQEK
VMLVHGRGFNWKDPDHFRIVYLPTVEELEDVQEKITRVLHQYKR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattattgaaaaatcatcaaaattagaacatgtcgcctacgacattcgaggtcct
gttttagacgaggccaaccgtatgattgctaacggtgaaaaaatccttcgattaaacacc
ggtaacccagcggcttttgggtttgaggctcctgatgaggtcatccgtgatttgattgtc
aatgcgaggcttagtgaagggtattcagatagcaagggtatcttttctgcccgcaaagcc
attatgcaatattgtcagctgaaaggtttcccggaggtagatattgaggatatttatttg
ggaaatggggtgtcagaattaatttccatgtcattacaagccctgcttgatgatggggat
gaggtgttggttcctatgccagattaccctctatggacagcctgtgtcagtctgggtggt
ggcaaagctgtgcattacttgtgtgatgaagaagcggattggtatcctgacattgctgat
atcaaatcaaaaatcacgagtcgcaccaaagctattgtggtcatcaaccctaacaatccc
actggtgccctttaccctaaagaagtcctagaagatattgttgcccttgcaagagagcac
cagctgattatttttgccgatgaaatctatgaccgattggttatggacggagaggagcat
gttgccattgctagtttagcgccagatgtattttgtgtatccatgaatggcttatcaaaa
tcccatcgtattgctggtttccgagtaggttggatggtcttatctgggccaaaagatcac
gtgaaaggctatatcgaaggattgaatatgctagcgaatatgcgcctctgctccaatgtg
ttggcccaacaggtagtgcaaacatctctaggcggtcgtcagtctgttgatgagctcttg
ttgccaggtggacgtatttttgagcaacgtaattttatccatgaagccatcaatgcgatt
ccaggcttatctgcagttaaacccaaagcaggtctttacctttttcctaagattgatcgt
aatatgtatcgtatcgatgatgatgaagaatttgtgctccaattattaaaacaagaaaag
gtgatgttggttcatggccgaggcttcaactggaaggacccagaccacttccgaattgtg
tacttaccaaccgtggaagaattagaagatgttcaggaaaaaatcacccgcgtcttacat
cagtacaaacgctaa

DBGET integrated database retrieval system