KEGG   Streptococcus dysgalactiae subsp. equisimilis GGS_124: SDEG_1849Help
Entry
SDEG_1849         CDS       T00932                                 

Gene name
alaT
Definition
(GenBank) aspartate aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
sds  Streptococcus dysgalactiae subsp. equisimilis GGS_124
Pathway
sds00220  Arginine biosynthesis
sds00250  Alanine, aspartate and glutamate metabolism
sds00290  Valine, leucine and isoleucine biosynthesis
sds01100  Metabolic pathways
sds01110  Biosynthesis of secondary metabolites
sds01130  Biosynthesis of antibiotics
sds01210  2-Oxocarboxylic acid metabolism
sds01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sds00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SDEG_1849 (alaT)
   00290 Valine, leucine and isoleucine biosynthesis
    SDEG_1849 (alaT)
   00220 Arginine biosynthesis
    SDEG_1849 (alaT)
Enzymes [BR:sds01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     SDEG_1849 (alaT)
    2.6.1.66  valine---pyruvate transaminase
     SDEG_1849 (alaT)
Amino acid related enzymes [BR:sds01007]
 Aminotransferase (transaminase)
  Class I
   SDEG_1849 (alaT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: BAH82331
UniProt: C5WIW6
Position
1:complement(1770013..1771227)
Genome map
AA seq 404 aa AA seqDB search
MKIIEKSSKLEHVAYDIRGPVLDEANRMIANGEKILRLNTGNPAAFGFEAPDEVIRDLIV
NARLSEGYSDSKGIFSARKAIMQYCQLKGFPEVDIEDIYLGNGVSELISMSLQALLDDGD
EVLVPMPDYPLWTACVSLGGGKAVHYLCDEEADWYPDIADIKSKITSRTKAIVVINPNNP
TGALYPKEVLEDIVALAREHQLIIFADEIYDRLVMDGEEHVAIASLAPDVFCVSMNGLSK
SHRIAGFRVGWMVLSGPKDHVKGYIEGLNMLANMRLCSNVLAQQVVQTSLGGRQSVDELL
LPGGRIFEQRNFIHEAINAIPGLSAVKPKAGLYLFPKIDRNMYRIDDDEEFVLQLLKQEK
VMLVHGRGFNWKDPDHFRIVYLPTVEELEDVQEKITRVLHQYKR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattattgaaaaatcatcaaaattagaacatgtcgcctacgacattcgaggtcct
gttttagacgaggccaaccgtatgattgctaacggtgaaaaaatccttcgattaaacacc
ggtaacccagcggcttttgggtttgaggctcctgatgaggtcatccgtgatttgattgtc
aatgcgaggcttagtgaagggtattcagatagcaagggtatcttttctgcccgcaaagcc
attatgcaatattgtcagctgaaaggtttcccggaggtagatattgaggatatttatttg
ggaaatggggtgtcagaattaatttccatgtcattacaagccctgcttgatgatggggat
gaggtgttggttcctatgccagattaccctctatggacagcctgtgtcagtctgggtggt
ggcaaagctgtgcattacttgtgtgatgaagaagcggattggtatcctgacattgctgat
atcaaatcaaaaatcacgagtcgcaccaaagctattgtggtcatcaaccctaacaatccc
actggtgccctttaccctaaagaagtcctagaagatattgttgcccttgcaagagagcac
cagctgattatttttgccgatgaaatctatgaccgattggttatggacggagaggagcat
gttgccattgctagtttagcgccagatgtattttgtgtatccatgaatggcttatcaaaa
tcccatcgtattgctggtttccgagtaggttggatggtcttatctgggccaaaagatcac
gtgaaaggctatatcgaaggattgaatatgctagcgaatatgcgcctctgctccaatgtg
ttggcccaacaggtagtgcaaacatctctaggcggtcgtcagtctgttgatgagctcttg
ttgccaggtggacgtatttttgagcaacgtaattttatccatgaagccatcaatgcgatt
ccaggcttatctgcagttaaacccaaagcaggtctttacctttttcctaagattgatcgt
aatatgtatcgtatcgatgatgatgaagaatttgtgctccaattattaaaacaagaaaag
gtgatgttggttcatggccgaggcttcaactggaaggacccagaccacttccgaattgtg
tacttaccaaccgtggaagaattagaagatgttcaggaaaaaatcacccgcgtcttacat
cagtacaaacgctaa

DBGET integrated database retrieval system