KEGG   Streptococcus dysgalactiae subsp. equisimilis GGS_124: SDEG_1894Help
Entry
SDEG_1894         CDS       T00932                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
sds  Streptococcus dysgalactiae subsp. equisimilis GGS_124
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:sds03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1823440..1825893
Genome map
AA seq 817 aa AA seqDB search
MEHFFTGTVDRIIFENAANFFKILLLAIEDTDSDIDDFEIIITGTMADIIEGDDYTFWGE
LTQHPKYGQQLKLSRYQKVKPSSSGLVNYFSSDHFKGIGKKTAEKIIALYGNNTIDHILE
DPSKLETISGLSKANRQAFVAKLKLNYGTEQLIAGLVELGLSNRFAFQAFEKYKEEALDL
VKENPYQLVEDLQGFGFKMADALAENLGIESDSPKRFRAALLHCLLEESVSRGDTYVQAR
QLLDFAITLLEDARQVECDSAAVAEQLSELIIEGKIKNSDTKLFDASLYFAEEGIAKNIS
RLLDTPLSQSFSHDTIQTTIQAVQEDFAITYDQVQQEAIAKALTSKVFLLTGGPGTGKTT
VIRGILQAYANLHQIDLDKKDLPILLAAPTGRAARRMNELTGLPSATIHRHLGLNGDNDY
QAMEDYLDCDLLIVDEFSMVDTWLANQLLAAISSTTQVIIVGDSDQLPSVGPGQVLSDLL
KVNSLPQIALQKIFRQSQESTIVDLADQMRRGILAADFRDKKADRSYFEAQASFIPDMIQ
KIVLSAIKSGIPAEEIQILAPMYKGQAGINHLNQLMQNLLNPLEGQTEFLFNDTHFRKGD
KVLHLVNDAQLNVFNGDIGYITDLIPAKYTESKQDELILDFDGSEVTYPRNEWLKLTLAY
AMSIHKSQGSEFQVVILPITRQSGRLLQRNLIYTAITRSKSKLIMLGEFAAFDYAIKNEG
DKRQTYLVERFQEQSDLASSQPNQELKSKEQTSLFSNTAALEDDSQKSSSQSTNSNPTEN
SQSDNDDFRLTPENYSTIDSMIGLTESDIALFFQKKS
NT seq 2454 nt NT seq  +upstreamnt  +downstreamnt
atggaacacttttttactggtactgttgaccgcattatctttgaaaatgcagctaatttt
tttaaaattctcctccttgccatcgaagacacagatagtgatattgacgactttgaaatc
attatcacagggacgatggctgacattattgaaggagatgactacaccttttggggggaa
ttgacccagcaccctaaatatggacagcaactcaaactaagccgttaccaaaaagtcaaa
cctagttcatctggtttggttaattatttctccagcgaccattttaaggggattggaaag
aaaacagcggagaaaatcattgccctctatggcaataatactattgaccatattttagaa
gacccaagtaaattagaaactatttctggtctgtccaaagctaatcgtcaagcctttgtc
gctaaactgaaattgaattatggcacagagcaactgattgctggtctcgtcgaacttggc
cttagcaaccgttttgcctttcaagcgtttgagaagtacaaagaagaggctcttgacctt
gttaaagaaaatccctatcaattagtcgaagatctacaaggttttgggtttaagatggca
gatgctctcgctgaaaacttagggattgagagcgactctccaaaacgttttcgtgctgcc
ctcctgcactgcctcttggaagaatccgtcagtcgaggagacacttatgtccaagcacga
caattattagactttgccatcacactccttgaagatgcacgtcaagtagaatgtgactct
gctgctgtggctgaacaactaagcgagttaatcatagagggcaaaatcaaaaacagtgac
accaaattgtttgatgctagcctttattttgctgaagaggggattgctaagaatatctct
cgtctcttagatacccctttaagtcagtcatttagtcatgataccatccaaacaaccatc
caagccgttcaagaagactttgctatcacttatgaccaggtgcagcaagaagccattgct
aaagccttaaccagcaaggtatttctcctaacaggtggtcccggaacagggaaaacaact
gttattcgaggcattttgcaggcttacgcgaacctgcatcagattgatttggataaaaaa
gaccttcctatcttgttagcagctccaacaggtcgggctgcacgtcgtatgaatgagttg
actggacttcctagcgcaaccatccacaggcacttaggcctcaacggcgacaacgattac
caagccatggaagattatctagactgcgacttgctgattgtcgatgaattttcaatggtg
gatacctggcttgctaaccaattgttagcagcgattagttcaacaactcaagtaattatt
gtcggagatagtgaccagcttccttcggttggacccggtcaagtcctgtcagatctttta
aaagtcaatagcctgccccaaatcgccttgcaaaagatatttcgtcaatcccaagaatct
actattgtagatttggcagaccagatgcgtcgaggaatcttagctgctgactttcgtgac
aaaaaagctgaccgttcttattttgaagcccaagcctctttcatcccggacatgattcaa
aaaattgttctatctgctattaaaagtggcatccctgctgaggaaattcaaattttagcg
cctatgtacaaaggacaggctggcatcaatcatcttaaccaattgatgcaaaacctcctc
aaccctttggaagggcaaacggaatttctgttcaatgatacgcattttcgtaaaggtgat
aaagtcttgcacttagtcaacgatgctcagttgaatgtctttaacggagatattggttat
attacagatttgattcctgctaaatataccgaatctaagcaagacgaattaatcttagat
tttgacggtagcgaagtaacgtaccctagaaatgaatggctaaaattaaccttagcctat
gccatgagcattcataagtcacaagggagcgagtttcaagtggtgattttacccatcaca
cgccaaagcggccgacttttgcaacgaaatttaatttatactgctatcacccgttctaaa
agtaagttgattatgctaggtgaatttgcagcctttgactatgctattaaaaatgaaggg
gataaacggcaaacttatttggtggaacgcttccaagaacaatccgacttagcctcctct
caacctaaccaagagctaaaatcaaaagagcagacctcccttttttctaatacggcagcc
cttgaggacgactctcaaaaatcttcctctcaatcaacaaactctaaccccactgagaac
tctcagtcagataatgatgattttaggttaacacctgagaattattcgactatcgattcg
atgatagggcttacagagtcagatattgccctctttttccagaaaaaatcctag

DBGET integrated database retrieval system