KEGG   Streptococcus dysgalactiae subsp. equisimilis GGS_124: SDEG_1967Help
Entry
SDEG_1967         CDS       T00932                                 

Gene name
gltX
Definition
glutamyl-tRNA synthetase (EC:6.1.1.17)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
sds  Streptococcus dysgalactiae subsp. equisimilis GGS_124
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:sds00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    SDEG_1967 (gltX)
Enzymes [BR:sds01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     SDEG_1967 (gltX)
Amino acid related enzymes [BR:sds01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   SDEG_1967 (gltX)
Transfer RNA biogenesis [BR:sds03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    SDEG_1967 (gltX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1899642..1901090)
Genome map
AA seq 482 aa AA seqDB search
MSTKPIRVRYAPSPTGLLHIGNARTALFNYLYARHHGGTFIIRIEDTDRKRHVEDGERSQ
LENLKWLGMDWDESPETHEQYRQSERLDLYQKYIDQLLAEGKAYKSYVTEDELAAERERQ
EAAGETPRYINEFLGMTEEQKAAYIAEREAAGIVPTVRLAVNEAGIYKWTDMVKGDIEFE
GGNIGGDWVIQKKDGYPTYNFAVVVDDHDMQISHVIRGDDHIANTPKQLMVYEALGWEAP
AFGHMTLIINSETGKKLSKRDTNTLQFIEDYRKKGYMPEAVFNFIALLGWNPGGEEEIFS
REQLIDLFDENRLSKSPAAFDQKKMDWMSNEYLKNADFETVYALCKPFLEEACRLTEKAE
KLVELYKPQLKSADEIIPLTDLFFSDFPELTEAEKEVMAGETVPTVLQAFKEKLEAMSDE
DFKPENIFPQIKAVQKETGIKGKNLFMPIRIAVSGEMHGPELPNTIYLLGRDKSIEHINK
ML
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacaaaaccaattcgtgtgcgttacgcaccaagtccaacgggattactacacatc
ggaaatgcgcggacagcgctctttaactacctttatgcacgtcatcatggcggtacgttt
atcattcggattgaagataccgaccgtaaacgtcacgtggaagacggtgaacgttcgcaa
ttagaaaacttaaaatggcttggtatggactgggatgaaagcccagaaacccatgagcaa
taccgccagtcagaacgtctagatctctaccaaaaatacattgatcaactattggcagaa
ggcaaggcctacaagtcttacgtgactgaagacgaattggcagccgagcgtgagcgccaa
gaagcagcaggtgagacaccacgctatatcaatgaatttcttggcatgacagaagagcaa
aaagcagcttacattgccgagcgtgaagcggcaggaattgttccaaccgttcgtttagct
gttaatgaagctggtatttacaaatggacggacatggttaaaggcgatattgagtttgaa
ggtggcaatatcggtggtgactgggttattcagaaaaaagatggttacccaacttacaac
tttgcggttgttgtagatgaccatgacatgcaaatttcacatgttatccgtggggatgac
catatagccaatacgccaaaacaattgatggtgtatgaagccctaggttgggaagcacca
gcctttggtcacatgacccttatcatcaattctgaaacagggaaaaaattatccaaacgc
gacaccaatactctccaatttatcgaagattaccgcaaaaaaggctatatgcctgaagct
gtctttaactttattgcacttttgggttggaatcctggcggagaagaggaaatcttctct
cgtgagcagttaattgacctttttgatgaaaatcgcctcagcaagtcgccagctgccttt
gatcagaagaaaatggattggatgagcaatgagtacttgaaaaatgcggattttgaaaca
gtttatgccctctgcaaacctttccttgaagaagcatgccgtttgactgaaaaagctgag
aagctagtagaattatacaaaccacagttaaaatctgcagatgagattattccactgacc
gatcttttcttctcagacttcccagaattgacagaagctgaaaaagaagtcatggcaggt
gaaactgttccgacagtcttgcaagctttcaaggaaaaattggaagctatgtcagatgaa
gacttcaaaccagaaaacattttcccacaaattaaggctgttcaaaaagaaacaggaatc
aagggtaaaaacctctttatgccaatccgtattgctgtttctggtgaaatgcatggccct
gaattaccaaatacaatctatttgctaggtcgtgacaaatctatcgaacatattaacaag
atgctttaa

DBGET integrated database retrieval system