KEGG   Streptococcus dysgalactiae subsp. equisimilis GGS_124: SDEG_1980Help
Entry
SDEG_1980         CDS       T00932                                 

Gene name
hasC
Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sds  Streptococcus dysgalactiae subsp. equisimilis GGS_124
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:sds00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sds00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sds00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sds00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1913570..1914472
Genome map
AA seq 300 aa AA seqDB search
MTKVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEEILVVTGKA
KRSIEDHFDSNFELEYNLQAKGKNELLKLVDETTAINLHFIRQSHPRGLGDAVLQAKAFV
GNEPFVVMLGDDLMDITNASAKPLTKQLMEDYDETHASTIAVMKVPHEDVSSYGVIAPQG
KAVNSLYSVDTFVEKPQPEDAPSDLAIIGRYLLTPEIFDILERQAPGAGNEVQLTDAIDT
LNKTQRVFAREFKGNRYDVGDKFGFMKTSIDYALEHPQVKEDLKNYIIKLGKALEKSETK
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaagtcagaaaagccattattcctgccgcaggtctaggaacacgttttttacct
gctaccaaagctcttgccaaagagatgttgcccatcgttgataaaccaaccatccagttt
atcgtcgaagaagcgctaaaatctggcatcgaggaaatccttgtggtgaccggaaaagct
aaacgctctatcgaggaccattttgattcaaactttgaattagaatacaacctccaagct
aaggggaaaaatgaactgttgaaattagtggatgaaaccactgccattaaccttcatttt
atccgtcaaagccacccaagaggactgggagatgctgtcttacaagccaaagcctttgtg
ggcaatgaaccctttgtggtcatgcttggagatgacttaatggacattacaaatgcatcc
gctaaacctctcaccaaacaactcatggaagactatgacgagacgcatgcatccactatc
gctgtgatgaaagttcctcatgaagatgtgtctagctatggggttatcgctcctcaaggc
aaggctgtcaatagcctttacagtgtagacacctttgttgaaaaaccacaaccagaagat
gcgcctagtgatttggctattattggtcgttacctcctaacccctgaaatttttgatatt
ttggaaagacaggctcctggagcaggtaacgaagtgcaactcactgatgctatcgatacc
ctcaataaaactcagcgtgtctttgcacgagaattcaaaggtaatcgttacgatgttggg
gataaatttggattcatgaaaacgtctatcgactatgccctagaacacccgcaggtcaaa
gaagacttgaaaaattacattatcaaactaggaaaagctttggaaaaaagtgaaactaag
taa

DBGET integrated database retrieval system