KEGG   Streptococcus dysgalactiae subsp. equisimilis GGS_124: SDEG_1980Help
Entry
SDEG_1980         CDS       T00932                                 

Gene name
hasC
Definition
(GenBank) UDP-glucose pyrophosphorylase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sds  Streptococcus dysgalactiae subsp. equisimilis GGS_124
Pathway
sds00040  Pentose and glucuronate interconversions
sds00052  Galactose metabolism
sds00500  Starch and sucrose metabolism
sds00520  Amino sugar and nucleotide sugar metabolism
sds01100  Metabolic pathways
sds01130  Biosynthesis of antibiotics
Module
sds_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sds00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SDEG_1980 (hasC)
   00052 Galactose metabolism
    SDEG_1980 (hasC)
   00500 Starch and sucrose metabolism
    SDEG_1980 (hasC)
   00520 Amino sugar and nucleotide sugar metabolism
    SDEG_1980 (hasC)
Enzymes [BR:sds01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SDEG_1980 (hasC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD Pep_M12B_propep
Motif
Other DBs
NCBI-ProteinID: BAH82462
UniProt: C5WJ97
Position
1:1913570..1914472
Genome map
AA seq 300 aa AA seqDB search
MTKVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEEILVVTGKA
KRSIEDHFDSNFELEYNLQAKGKNELLKLVDETTAINLHFIRQSHPRGLGDAVLQAKAFV
GNEPFVVMLGDDLMDITNASAKPLTKQLMEDYDETHASTIAVMKVPHEDVSSYGVIAPQG
KAVNSLYSVDTFVEKPQPEDAPSDLAIIGRYLLTPEIFDILERQAPGAGNEVQLTDAIDT
LNKTQRVFAREFKGNRYDVGDKFGFMKTSIDYALEHPQVKEDLKNYIIKLGKALEKSETK
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaagtcagaaaagccattattcctgccgcaggtctaggaacacgttttttacct
gctaccaaagctcttgccaaagagatgttgcccatcgttgataaaccaaccatccagttt
atcgtcgaagaagcgctaaaatctggcatcgaggaaatccttgtggtgaccggaaaagct
aaacgctctatcgaggaccattttgattcaaactttgaattagaatacaacctccaagct
aaggggaaaaatgaactgttgaaattagtggatgaaaccactgccattaaccttcatttt
atccgtcaaagccacccaagaggactgggagatgctgtcttacaagccaaagcctttgtg
ggcaatgaaccctttgtggtcatgcttggagatgacttaatggacattacaaatgcatcc
gctaaacctctcaccaaacaactcatggaagactatgacgagacgcatgcatccactatc
gctgtgatgaaagttcctcatgaagatgtgtctagctatggggttatcgctcctcaaggc
aaggctgtcaatagcctttacagtgtagacacctttgttgaaaaaccacaaccagaagat
gcgcctagtgatttggctattattggtcgttacctcctaacccctgaaatttttgatatt
ttggaaagacaggctcctggagcaggtaacgaagtgcaactcactgatgctatcgatacc
ctcaataaaactcagcgtgtctttgcacgagaattcaaaggtaatcgttacgatgttggg
gataaatttggattcatgaaaacgtctatcgactatgccctagaacacccgcaggtcaaa
gaagacttgaaaaattacattatcaaactaggaaaagctttggaaaaaagtgaaactaag
taa

DBGET integrated database retrieval system