KEGG   Staphylococcus pseudintermedius ED99: SPSE_0056Help
Entry
SPSE_0056         CDS       T02008                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
sdt  Staphylococcus pseudintermedius ED99
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sdt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SPSE_0056
  Amino acid metabolism
   00300 Lysine biosynthesis
    SPSE_0056
Enzymes [BR:sdt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     SPSE_0056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
64863..66029
Genome map
AA seq 388 aa AA seqDB search
MSVLSSDEKIQILRDIIEIQSVNDYEVEVAQYLKNLFDKYQINAQILKLENSETRANLVA
EIGSGHPVLGVSGHMDVVNVGDITTWQYEPFQLTEDEDGRLHGRGTADMKAGLAALVISM
IEIKEAGLLKKGTIRLLATAGEEIASEGAAQLREQGYTDDLDALLIAEPSQNGMFYAHKG
SMHFELTSRGKSAHSSMPELGINAITPVVNFIYHLNEAFQHVHERNHIIGPPTMASTVIQ
GGDQVNSIPDKATALFNVRTVTEYNSQSFMALFQSIQERVSDDHHRLTLQAYGDRSPVVT
TGENRLVNLAQDISEKYFGEKVKKIASTGVTDASLLLKDKDIHFPFITFGPGETSQAHQV
DEYVQKDVYLTFIQLYQEMFTTYLNDEK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgtcagttttaagttcagatgaaaaaattcaaattttacgtgacatcatcgaaatccag
tcagttaacgattatgaggttgaagtggctcagtatttaaaaaatttgtttgataaatat
caaattaatgctcaaattttaaaactagaaaatagtgagacacgtgcgaacttagtagca
gaaattggctcagggcaccccgttcttggtgtttcaggtcatatggatgtagtgaatgta
ggagatataacaacatggcaatatgaaccatttcagctaacggaggatgaagatggccga
ttacatggtcgtggcacagcggatatgaaagcaggtctcgcagcactcgtaataagtatg
attgaaattaaagaagcgggattattgaagaaagggacgattcgtctattagcaacggct
ggtgaagaaattgccagtgaaggggcagcgcaattaagagaacaaggttatactgatgat
ttggatgctttattgattgcagaaccttcacaaaatggtatgttttacgcacataaaggg
tctatgcatttcgaattaacatccagaggtaaatctgcgcacagctctatgccagagtta
gggatcaatgccattacacctgttgtaaactttatttatcatttgaatgaggcgtttcaa
cacgtccatgaacgtaatcatatcataggaccgccaacaatggcctctacggttatccaa
ggtggggatcaggtgaactctattccagacaaagcaacagccttattcaatgtacggaca
gtgacagaatacaatagtcaaagttttatggcgttatttcaatcgattcaagaacgtgta
agcgatgatcaccatcgtctcacactccaagcatatggggaccgctcacctgttgtcact
acaggagaaaatcgtctggttaaccttgcgcaagatatcagcgaaaaatactttggcgaa
aaagttaaaaagattgcttcaacgggggttacggacgcatcgcttttattaaaagataaa
gatattcattttccatttataacctttggacctggtgaaacatcacaagcccatcaagtt
gatgaatatgtccaaaaagacgtttatttaacttttattcagttatatcaggaaatgttt
acaacttatttgaatgatgaaaaataa

DBGET integrated database retrieval system