KEGG   Staphylococcus pseudintermedius ED99: SPSE_0106Help
Entry
SPSE_0106         CDS       T02008                                 

Definition
glycosyl hydrolase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
sdt  Staphylococcus pseudintermedius ED99
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:sdt00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SPSE_0106
Enzymes [BR:sdt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     SPSE_0106
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
120972..122744
Genome map
AA seq 590 aa AA seqDB search
MSRFKISDTFLLDDKPIKILSGAIHYFRIPKDDWEDSLYNLKALGFNTVETYVPWNFHET
IENEYDFKGHKDLKHFIELAAKLGLYVIVRPSPYICAEWEFGGFPAWLLNDRTMRIRSRD
EKYLEKVKKYYHELFKILTPLQIDQGGPIIMMQVENEYGSFGQDHDYLRSLAHMMREEGV
TVPFFTSDGAWDQCLRAGSLIEDDILPTGNFGSRTVQNFENLKTFQQEFSKKWPLMCMEF
WDGWFNRWGEPVIKRDSDDLAEEVRDAVKLGSLNLYMFHGGTNFGFWNGCSARGTKDLPQ
VTSYDYHAPLDEAGNPTEKYFALQEMLKEEMPDIEQHEPRTKTFMSMKAIPLAAKVNLFE
VLEDISTKTTSFYPQTMEEAGSGYGYMVYRTRIHKATEQEKLRIVDARDRVHCFVDQQHV
YTAYQEEIGDQFEVTLTSDQPQIDVLIENMGRVNYGYKLLAPTQRKGLGQGLMQDLHFVQ
GWEQFDIDFDRLTANHFKREWSEQQPAFYKYTFDLAESNNTHIDVSGFGKGVVLVNGFNI
GRYWEIGPSQSLYIPKAFLKQGQNEIIVFDSEGKYPESIQLIETPKFSEV
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
gtgagtcgtttcaaaataagcgatacatttttattagatgacaaaccaatcaaaatattg
tccggtgccatccattactttagaataccaaaggatgactgggaagattcattatacaat
ttaaaagcactcggatttaatacagtggaaacttatgtcccttggaactttcatgaaacg
attgaaaatgaatacgacttcaaaggacataaagatttaaaacattttatcgaacttgca
gcaaagcttggactttacgtcatcgtacgaccttctccttacatttgtgcggagtgggag
ttcggtggatttccagcatggttattgaatgaccgtacaatgcgcatccgttcgagagat
gagaaatatttagaaaaagtgaaaaaatattatcatgaactgtttaaaatcttaacgcca
ttgcaaattgatcaaggcggcccgattatcatgatgcaagtcgaaaatgaatacggttca
ttcggtcaagatcacgactatttacgttcacttgctcacatgatgcgtgaagaaggtgtg
acagtaccatttttcacatcagacggtgcttgggatcaatgtttaagagcggggagtctc
attgaagacgatattttaccgactggcaattttggttcacgtacagttcaaaatttcgaa
aacctaaagacgttccaacaagaatttagtaaaaagtggccgttaatgtgtatggaattt
tgggatggctggtttaatcgctggggcgaacctgtgattaaacgagacagtgatgatttg
gctgaagaagtgcgcgatgcagtgaaattaggctcacttaatttatatatgttccatggg
gggacaaactttggtttttggaacggttgctcggcacgtggtacgaaagatttaccacaa
gtgacatcttatgactatcatgcgccgttagatgaggcgggtaatccaacagaaaaatac
tttgctttacaagagatgctcaaagaagaaatgcctgacatagagcaacatgagccaaga
acgaaaacatttatgtcaatgaaagctattccattggcagccaaagtgaatttattcgaa
gtacttgaagacatttcaacaaaaacgacaagcttctacccacaaacgatggaagaagcg
ggttctggatatggttatatggtatatcgtacgcgtatccataaagcgacagaacaagaa
aaattacgaattgtagatgcaagagaccgtgtccactgttttgtagaccaacaacatgtc
tacacagcgtatcaagaagaaattggagatcagtttgaagtcacattaacgtctgaccaa
ccacaaatcgatgtgctcattgaaaatatgggtcgtgtcaactacggctacaaattatta
gcaccgacacaacgtaaaggtttaggtcaaggactcatgcaagatcttcattttgtacaa
ggttgggaacaattcgatatcgacttcgaccgtttaacagcgaatcatttcaaacgtgaa
tggtctgaacaacaacctgctttttacaaatacacatttgacttagcagagtcgaacaat
acgcatattgatgtaagcggtttcggaaaaggtgttgtactcgtcaacggattcaacatc
ggtcgttattgggaaattggaccgtcacaatcgctctacattcctaaagcatttttgaaa
caaggacaaaatgaaattatcgtgtttgactcagaaggaaaatatccagaaagtatccaa
ctgatcgaaacaccaaaattttctgaagtataa

DBGET integrated database retrieval system