KEGG   Staphylococcus pseudintermedius ED99: SPSE_0127Help
Entry
SPSE_0127         CDS       T02008                                 

Definition
hypothetical protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
sdt  Staphylococcus pseudintermedius ED99
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sdt00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SPSE_0127
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SPSE_0127
Enzymes [BR:sdt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SPSE_0127
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
144352..145386
Genome map
AA seq 344 aa AA seqDB search
MKWGFSIGLSLMLIFTTFQSEAVAPKFQKGVNIDIARKDYSLETIKEIVDTIAKYDGDYL
QLHFADDQHHAVDLPGMSPTKRDTLSYEEIKTLIKYSNKRDVMVVPDIDFPSHAGALLQQ
LKKQDKARYKTVVSGFSTNTVDYFDNQEAVKWSSEYLKDVMSLFEQPKFKGEQRIVIGGD
EVPGAMDHQKAFVHFMNKLAETAKNKGYQPQIWNDSLTKQGVQQLDAHVSVLYWNQHEAT
HRQQAHVEDLAKANISVFNYNASTLYFLPSSQHSKQTIQQQQQFIERYYADNRFNYFNDA
HHVVAQPNIQGSALSFWGEHAETLSQQEILQQLQPLIKTYLTQN
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggggattttcaatagggttaagtttaatgctcatcttcacaacgtttcaaagt
gaagcagtcgcacctaaatttcaaaaaggggtgaatattgatattgcacgtaaagattat
tcgctggagacaattaaagagattgttgatacgatagcaaaatatgatggggactattta
cagttgcactttgctgacgatcaacaccatgcggttgatttaccaggtatgtcaccaacg
aagcgggatacattgtcatatgaggaaattaaaacgctcatcaaatatagcaataagcgt
gacgttatggtagtgcccgatattgattttccgtcacatgcgggtgcgttgctacaacag
ttgaaaaaacaagataaagctcgatataaaacggtcgtgtccggttttagtacgaacact
gtagactattttgataatcaagaagcagtcaaatggagcagcgaatatttaaaagacgtg
atgtcgttgtttgaacagccaaaatttaaaggagaacaacgaattgttattggaggagat
gaggtgcctggagcgatggaccatcaaaaagcattcgtacatttcatgaataaattagct
gaaacagcaaaaaataaaggctaccaaccccaaatttggaatgatagccttacaaagcaa
ggtgttcagcagttagatgcacatgtttctgtcttatattggaatcaacacgaagccaca
catcgtcagcaagcacatgtagaggatttggcaaaagcaaatatctctgtgtttaactac
aatgcatcaactttatattttttaccatcgtctcaacattctaaacaaacgattcaacag
caacaacaatttattgaacgttattatgctgacaatcgatttaattattttaatgatgca
catcatgtcgtcgcccaaccgaatattcaaggttctgcattgtcattttggggtgagcat
gcggagacgttgtcacaacaagaaatactccaacaacttcaaccactcatcaaaacgtat
ttaacccaaaattaa

DBGET integrated database retrieval system